Conserved Protein Domain Family
ribB

?
PRK01792: ribB 
3,4-dihydroxy-2-butanone-4-phosphate synthase
Statistics
?
PSSM-Id: 167278
View PSSM: PRK01792
Aligned: 12 rows
Threshold Bit Score: 425.461
Threshold Setting Gi: 148827954
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16272705    1 MNQSILSPFGnTAEERVLNAINAFKNGTGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQLD 80 
152977863   1 MNQSLLSSFG-TSEERVIKAIEAFKQGNGVLVLDNEDRENEGDLIFPAETITPEQMAILIRYGSGITCLCITDELCKQLD 79 
152978170   1 MNQSLLAQFG-TAEERVIKAINAFKQGNGVLVLDDENRENEGDLIFPAETITTEQMAKLIRFGSGIVCLCITDELCQQLD 79 
68249360    1 MNQSILSPFGnTAEERVLNAINAFKHGTGVLVLDDEDRENEGDLIFPAETITSEQMAKLIRYGSGIVCLCITDERCQQLD 80 
148826593   1 MNQSILSPFGnTAEERVLNAINAFKNGNGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQLD 80 
148827954   1 MNQSILSPFGnTAEERVLNAINAFKNGTGVLVLDDEDRENEGDLIFPAETITPEQMAKLIRYGSGIVCLCITDERCQQLD 80 
15603250    1 MNQSILSPFG-QSEERAIAAINAFKQGNGVLVLDDEDRENEGDLIFPAETITVEQMTMLIRYGSGIVCLCLSDEICQQLD 79 
113460238   1 MNQSLLSQFG-TSEERVKRAIEAFKRGNGVLVLDDEDRENEGDLIFPAETITVEQMAKLIRYGSGIVCLCITDELCQQLD 79 
170718280   1 MNQSLLSQFG-TSEERVKRAIEAFKRGNGVLVLDDEDRENEGDLIFPAETITVEQMAKLIRYGSGIVCLCITDELCQQLD 79 
251793550   1 MNQSLLAPFG-TAEERVKNALEAFKQGNGVLVLDDEDRENEGDLIFPAETITTEQMAMLIRHGSGIVCLCIKDELCKQLD 79 
261866871   1 MNQSLLSPFG-TAEERVKAAIDAFKQGDGVLVLDDENRENEGDLIFPAETITAAQMAKLIRYGSGIVCLCITDELCKQLD 79 
52424227    1 MNQSLLASFG-SSEERVIAALDTFKQGNGVLVLDDENRENEGDLIFPAETITTEQMAKLIRYGSGIVCLCITDELCQKLE 79 
16272705   81 LPPMVEHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVLTDLHRPGHVFPLRAANGGVLTRRGHTEASVD 160
152977863  80 LPPMVQCNTSVNKTAFTVTIEAASGVSTGVSASDRVTTIKAAISVGAKPEDLHRPGHVFPLCAVEGGVLARGGHTEAAVD 159
152978170  80 LPPMVQNNSSVNKTAFTVTIEAAQGVSTGVSAADRVTTVKAAVADNAKPSDLHRPGHIFPLRAAKGGVLTRRGHTEAAVD 159
68249360   81 LPPMVEHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFPLRAANGGVLTRRGHTEASVD 160
148826593  81 LPSMVEHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFPLRAANGGVLTRRGHTEASVD 160
148827954  81 LPSMVEHNNSVNKTAFTVTIEAAKGVSTGVSAADRVTTIQTAIADNAVPTDLHRPGHVFPLRAVNGGVLTRRGHTEASVD 160
15603250   80 LPPMVTENTSVNKTAFTVTIEAAKGVSTGVSATDRVTTIRAAVADNAKPSDLSRPGHIFPLRAMTGGVLKRRGHTEASVD 159
113460238  80 LSPMVQNNTSINQTAFTVSIEAAQGVSTGVSAQDRVTTIQAAIADNAKPQDLSRPGHVFPLRAKKGGVLARRGHTEAAVD 159
170718280  80 LPPMVQNNTSINQTAFTVSIEAAQGVSTGVSAQDRVTTIQVAIADNAKPQDLSRPGHVFPLRAKKGGVLARRGHTEAAVD 159
251793550  80 LPPMVSNNTSVNKTAFTVTIEAATGVSTGVSAADRVTTIKTAIADGAKPSDLHRPGHVFPLRAAANGVLQRNGHTEAAVD 159
261866871  80 LPPMVNHNTSVNKTAFTVTIEAAEGVSTGVSAADRVTTIKAAIADGAKPSDLHRPGHVFPLRAAPNGVLQRNGHTEAAVD 159
52424227   80 LPPMVAANTSVNKTAFTVTIEAAEGVSTGVSAADRVTTVKVAVADNAKPSDLHHPGHVFPLRAAENGVLARPGHTEAAVD 159
16272705  161 LARLAGFKEAGVICEITNDDGTMARAPEIVEFAKKFGYSVLTIEDLVEYRLAHNI 215
152977863 160 LARLSGYREAGVICEITNDDGTMARTPELVEFVKKFGYAIVTIEDIIGYRKKYDC 214
152978170 160 LALLAGYKPAGVICEITNDDGTMARAPQLVKFAQEFNYAVVTIEDLVAYLTK--- 211
68249360  161 LARLAGFKEAGVICEITNDDGTMARTPEIVEFAKKFGYSVLTIEDLVEYRLAHNI 215
148826593 161 LARLAGFKEAGVICEITNDDGTMARTPDIVEFAKKFGYSVLTIEDLVEYRLAHNI 215
148827954 161 LARLAGFKEAGVICEITNDDGTMARTPDIVEFAKKFGYSVLTIEDLVEYRLANNI 215
15603250  160 LARLAGYKAAGVICEITNDDGSMARAPEIVTFAQKFGFPVVTIEDLVAYRQKYDV 214
113460238 160 LASWAGHKPAGVICEITNDDGSMARTPEIVEFGKKFNYPVVTIEDLVRYASNK-- 212
170718280 160 LASWAGHKPAGVICEITNDDGSMARTLEIVEFGKKFNYPVVTIEDLVRYSSSKVV 214
251793550 160 LAHLAGYKEAGVICEITNDNGTMARTPELIEFVKKHGYPIVTIEDLIEYRKKFNC 214
261866871 160 LARLAGYKEAGVICEITNDDGTMARAPELVEFVKQQGYAIVTIEDLITYRQKYHC 214
52424227  160 LARLCGYKPAGVICEITNDDGTMARTPELVAFAQKFGYAVVTIEDLIAYRTKYNK 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap