Conserved Protein Domain Family
PRK01713

?
PRK01713: PRK01713 
ornithine carbamoyltransferase; Provisional
Statistics
?
PSSM-Id: 167263
View PSSM: PRK01713
Aligned: 11 rows
Threshold Bit Score: 739.876
Threshold Setting Gi: 152979173
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
126208781   1 MAFNLKNRHLLSLVNHTEREIKFLLDLSRDLKRAKYAGTEQQRLKGKNIALIFEKTSTRTRCAFEVAAYDQGAHVTYIDP 80 
152979173   1 MPFNLKNRHLLSLVHHTPREIQFLLDLARELKHAKYTGTEQPRLKGKNIALIFEKTSTRTRCSFEVAAYDQGANVTYLDP 80 
190150637   1 MAFNLKNRHLLSLVNHTEREIKFLLDLSRDLKRAKYAGTEQQRLKGKNIALIFEKTSTRTRCAFEVAAYDQGAHVTYIDP 80 
165976738   1 MAFNLKNRHLLSLVNHTEREIKFLLDLSRDLKRAKYAGTEQQRLKGKNIALIFEKTSTRTRCAFEVAAYDQGAHVTYIDP 80 
16272539    1 MAFNMKNRHLLSLVHHTEREIKYLLDLSRDLKRAKYAGTEQQKLKGKNIALIFEKTSTRTRCAFEVAAYDQGAQVTYIDP 80 
68249197    1 MAFNMKNRHLLSLVHHTEREIKYLLDLSRDLKRAKYAGTEQQKLKGKNIALIFEKTSTRTRCAFEVAAYDQGAQVTYIDP 80 
148827789   1 MAFNMKNRHLLSLVHHTEREIKYLLDLSRDLKRAKYAGTEQQKLKGKNIALIFEKTSTRTRCAFEVAAYDQGAQVTYIDP 80 
33151477    1 MAFNLKNRHLLSLVNHTEREIKYLLALARDLKRAKYSGTEQQTLKGKNIALIFEKTSTRTRCAFEVAAYDQGAQVTYIDP 80 
251793821   1 MAFNLKNRHLLSLVNHSEREIKYLLDLSRDLKRAKYAGTEQQKLKGKNIALIFEKTSTRTRCAFEVAAYDQGAQVTYIDP 80 
261866805   1 MAFNLKNRHLLSLVNHSEREINYLLDLSRDLKRAKYAGTEQQKLKGKNIALIFEKTSTRTRCAFEVAAYDQGAQVTYIDP 80 
52425128    1 MPFNLKNRHLLSLVNHSPREIKYLLDLARDLKRAKYAGTEQPRLKGKNIALIFEKTSTRTRCSFEIAAYDQGANVTYIDP 80 
126208781  81 TSSQIGHKESMKDTARVLGRMYDAIEYRGFKQSVVNELAEYAGVPVFNGLTDEFHPTQMLADVLTMIENCEKPLSQISYV 160
152979173  81 VSSQIGHKESIKDTARVLGRLYDAIEYRGFSQQIVKDLAKYSGVPVFNGLTDEFHPTQMLADVLTMLEHSTKPLNEISYV 160
190150637  81 TSSQIGHKESMKDTARVLGRMYDAIEYRGFKQSVVNELAEYAGVPVFNGLTDEFHPTQMLADVLTMIENCEKPLSQISYV 160
165976738  81 TSSQIGHKESMKDTARVLGRMYDAIEYRGFKQSVVNELAEYAGVPVFNGLTDEFHPTQMLADVLTMIENCEKPLSQISYV 160
16272539   81 NSSQIGHKESMKDTARVLGRMYDGIEYRGFKQSIVQELADYAGVPVFNGLTDEFHPTQMLADVLTMIEHCDKPLSEISYV 160
68249197   81 NSSQIGHKESMKDTARVLGRMYDGIEYRGFKQSIVQELADYAGVPVFNGLTDEFHPTQMLADVLTMIEHCDKPLSEISYV 160
148827789  81 NSSQIGHKESMKDTARVLGRMYDGIEYRGFKQSIVQELADYAGVPVFNGLTDEFHPTQMLADVLTMIEHCDKPLSEISYV 160
33151477   81 NSSQIGHKESMKDTARVLGRMYDAIQYRGFKQATVNELAKYAGVPVFNGLTDEFHPTQMLADVLTMLENCEKPLNQISYV 160
251793821  81 NSSQIGHKESMKDTARVLGRMYDAIEYRGFKQEIVDELAEYAGVPVFNGLTDEFHPTQMLADVLTMIENCDKPLSEIKYV 160
261866805  81 NSSQIGHKESMKDTARVLGRMYDAIEYRGFKKEIVDELAEYAGVPVFNGLTDEFHPTQMLADVLTMIENCDKPLSEISYV 160
52425128   81 TSSQIGHKESMKDTARVLGRLYDAIEYRGYKQETVEELAKFSGVPVFNGLTDEFHPTQMLADVLTMIEHSTKPLNEIKYV 160
126208781 161 YIGDARNNVGNSLLLIGAKLGMDVRICAPKALLPEDSLVEMCQKFAAESGARITVTDDIDTAVKGVDFVHTDVWVSMGEP 240
152979173 161 YIGDARNNMGNSLLLIGAKLGMDVRICAPKALLPEEKLVVMCREFAEETGARITVTEDIDTAVRNVDFVHTDIWVSMGEP 240
190150637 161 YIGDARNNVGNSLLLIGAKLGMDVRICAPKALLPEDSLVEMCQKFAAESGARITVTDDIDTAVKGVDFVHTDVWVSMGEP 240
165976738 161 YIGDARNNVGNSLLLIGAKLGMDVRICAPKALLPEDSLVEMCQKFAAESGARITVTDDIDTAVKGVDFVHTDVWVSMGEP 240
16272539  161 YIGDARNNMGNSLLLIGAKLGMDVRICGPKALLPEANLVEMCEKFAKESGARITVTEDIDKAVKGVDFIHTDVWVSMGEP 240
68249197  161 YIGDARNNMGNSLLLIGAKLGMDVRICGPKALLPEANLVEMCEKFAKESGARITVTEDIDKAVKGVDFIHTDVWVSMGEP 240
148827789 161 YIGDARNNMGNSLLLIGAKLGMDVRICAPKALLPEASLVEMCEKFAKESGARITVTEDIDKAVKGVDFVHTDVWVSMGEP 240
33151477  161 YMGDARNNMGNSLLLIGAKLGMDVRICAPQALLPEDSLVTLCQQFAQQSNARITITDDIDLAIQGVDFIHTDVWVSMGEP 240
251793821 161 YIGDARNNMGNSLLLIGAKLGMDVRICGPKALLPDAELVEMCEGFAKQSGARITVTDDIDKAVKGVDFVHTDVWVSMGEP 240
261866805 161 YIGDARNNMGNSLLLIGAKLGMDVRICGPKALLPDAGLVEMCEGFAKQSGARITVTDDIDKAVKGVDFVHTDVWVSMGEP 240
52425128  161 YIGDARNNMGNSLLLIGAKLGMDVRICGPKSLLPEENFVSICEEISKETGARLTVTDDIDLAVKDADFVHTDVWVSMGEP 240
126208781 241 LETWGERIDMLMPYQVTPELMKRTGNPKVKFMHCLPAFHNSETKIGKQVAEKYPALANGIEVTEDVFESPANVAFEQAEN 320
152979173 241 LEAWGERIDLLMPYQVTLDLMKRTGNPGVKFMHCLPAFHNCETKVGQEIAAKYPALANGIEVTEEVFESPMNIAFEQAEN 320
190150637 241 LETWGERIDMLMPYQVTPELMKRTGNPKVKFMHCLPAFHNSETKIGKQVAEKYPALANGIEVTEDVFESPANVAFEQAEN 320
165976738 241 LETWGERIDMLMPYQVTPELMKRTGNPKVKFMHCLPAFHNSETKIGKQVAEKYPALANGIEVTEDVFESPANVAFEQAEN 320
16272539  241 LETWGERIKLLLPYQVTPELMKRTGNPKVKFMHCLPAFHNSETKVGRQIAEKYPELANGIEVTEEVFESPMNIAFEQAEN 320
68249197  241 LETWGERIKLLLPYQVTPELMKRTGNPKVKFMHCLPAFHNSETKVGRQIAEKYPELANGIEVTEEVFESPMNIAFEQAEN 320
148827789 241 LETWGERIKLLLPYQVTPELMKRTGNPKVKFMHCLPAFHNSETKVGRQIAEKYPELANGIEVTEEVFESPMNIAFEQAEN 320
33151477  241 LETWGERINMLMPYQVTPALMQRTGNPNVKFMHCLPAFHNSETTMGKQIAEQYPQLANGIEVIEEVFESSANIAFEQAEN 320
251793821 241 LETWGERIKLLLPYQVTPELMKRTGNPRVKFMHCLPAFHNSETKVGRQIAEKYPELANGIEVTEDVFESPMNVAFEQAEN 320
261866805 241 LETWGERIKLLLPYQVTPELMKRTGNPRVKFMHCLPAFHNSETKVGRQIAEKYPELANGIEVTEDVFESPMNVAFEQAEN 320
52425128  241 IEAWGERINLLMPYQVNTDLMKRTGNPNVKFMHCLPAFHNCETKVGREIAAAYPNLANGIEVTEDVFESPMNIAFEQAEN 320
126208781 321 RMHTIKAVMVASLA 334
152979173 321 RMHTIKAVMVASLA 334
190150637 321 RMHTIKAVMVASLA 334
165976738 321 RMHTIKAVMVASLA 334
16272539  321 RMHTIKAVMVASLA 334
68249197  321 RMHTIKAVMVASLA 334
148827789 321 RMHTIKAVMVASLA 334
33151477  321 RMHTIKAVMVASLA 334
251793821 321 RMHTIKAVLYSSLI 334
261866805 321 RMHTIKAVLYSSLI 334
52425128  321 RMHTIKAVMVASLA 334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap