Conserved Protein Domain Family
PRK01706

?
PRK01706: PRK01706 
adenosylmethionine decarboxylase
Statistics
?
PSSM-Id: 167260
View PSSM: PRK01706
Aligned: 21 rows
Threshold Bit Score: 222.376
Threshold Setting Gi: 51891559
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30023246    1 MEYSTFGKHIIVDLWGVDFSLLDDMHFLEYHLVTAADYSGAHVLNVSKKEFQPYGVTVLVLLSESHLSIHTYPEQNFAAI 80 
222098667   1 MEYSTFGKHIIVDLWGVDFSLLDDIYFLEHHLVHAADQSGAHVLNVSTKEFNPHGVTVLVLLSESHLSIHTYPEKNFAAI 80 
218900331   1 MEYSTFGKHIIVDLWGVDFSLLDDTHFLEYHLVTAADCSGAHVLNVSKKEFQPYGVTVLVLLSESHLSIHTYPEQNFAAI 80 
218233937   1 MEYSTFGKHIIVDLWGVDFSLLDDMQFLEYHLVTAADYSGAHVLNVSKKEFQPYGVTVLVLLSESHLSIHTYPEQNFAAI 80 
217962694   1 MEYSTFGKHIIVDLWGVDFSLLDDIYFLEHHLVHAADQSGAHVLNVSTKEFNPHGVTVLVLLSESHLSIHTYPEKNFAAI 80 
225867175   1 MEYSTFGKHIIVDLWGVDFSLLDDMYFLEHHLVHAAALSGAHVLNVSTKEFHPHGVTVLVLLSESHLSIHTYPEKNFAAI 80 
118480248   1 MEYSTFGKHIIVDLWGVDFSLLDDMYFLEHHLVHAAALSGAHVLNVSTKEFHPHGVTVLVLLSESHLSIHTYPEKNFAAI 80 
167628346   1 MDYSTFGRHVTVDTWGVDFEKLNDARFLEEQMIEAARAAGATVLSSQKQQFEPQGATVLVLLSESHISIHTYPEKGFAAL 80 
251798417   1 MEYSTFGRHVAVDTWGVDFDLLNNAEFLQAQMVEAAEACGATVLSVQSKQFEPQGATVLVLLSESHLSIHTYPEKGFAAL 80 
226313474   1 MEYSTFGRHVAVDTWGVQFDLLNDAEFLKKEMIEAAEACGATVLSVQAKQFSPQGATVLVLLSESHLSIHTYPERGFAAL 80 
30023246   81 DCYTCGTTVEPQIAIDYIVNILKPERMHIKRLIRGIGEIVTAD 123
222098667  81 DCYTCGTTVEPQIAIDYIVSILKPNEMHIKKLIRGIGEIVTVD 123
218900331  81 DCYTCGTTVEPQIAIDYIVNILKPERMHIKRLIRGIGEIVTAD 123
218233937  81 DCYTCGTTVEPQISIDYIVNILKPERMHIKRLIRGIGEIVTAD 123
217962694  81 DCYTCGTTVEPQIAIDYIVSILKPNEMHIKKLIRGIGEIVTVD 123
225867175  81 DCYTCGTTVEPQIAIDYIVSILEPNEMHIKRLIRGIGEIVNTD 123
118480248  81 DCYTCGTTVEPQIAIDYIVSILEPNEMHIKRLIRGIGEIVNTD 123
167628346  81 DCYTCGETVDPEVAISHMIKVLVPKKTSVKLLKRGDGPIEVLK 123
251798417  81 DCYTCGETVDPQLAIDYMIAVLKPTTTHAKKLVRGMGELKVEE 123
226313474  81 DCYTCGETVDPQIAIDYLVSVLKPEKTYAKKLVRGLGELQVVE 123
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap