Conserved Protein Domain Family
PRK01658

?
PRK01658: PRK01658 
CidA/LrgA family holin-like protein
Statistics
?
PSSM-Id: 167253
View PSSM: PRK01658
Aligned: 53 rows
Threshold Bit Score: 122.447
Threshold Setting Gi: 169829554
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157694234   1 MKLLKTpliaVLQIMALFVFAKLMNVLAAFLHLRIPGTILGILVIFLLLHFKIIQLKWIELGAVWLLGELLLFFIPSAVG 80 
30021766    1 MKWWKL----SGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELILFFIPSAVA 76 
218898763   1 MKWWKL----SGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELILFFIPSAVA 76 
218230950   1 MKWWKL----SGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELILFFIPSAVA 76 
217961084   1 MKWWKL----SGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELILFFIPSAVA 76 
218904802   1 MKWWKL----SGQILLLFCFAWTGEWITKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELILFFIPSAVA 76 
225865652   1 MKWWKL----SGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELILFFIPSAVA 76 
301055158   1 MKWWKL----SGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELILFFIPSAVA 76 
163941273   1 MKWWKL----SGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNIVKKEWIQDGADFLLKELILFFIPSAVA 76 
49478958    1 MKWWKL----SGQILLLFCFAWTGEWIAKQAHLPVPGSIIGIFLLLISLKFNLVKKEWIQDGADFLLKELILFFIPSAVA 76 
157694234  81 VIDYGTLLSQSGTSIVLVVLLSTFVVMLSTGIMTQMIAKRKERKK 125
30021766   77 VIRYRDTLTQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSTQ 121
218898763  77 VIRYRDTLTQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSTQ 121
218230950  77 VIRYRDTLTQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSTQ 121
217961084  77 VIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSVQ 121
218904802  77 VIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSVQ 121
225865652  77 VIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSVQ 121
301055158  77 VIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSVQ 121
163941273  77 VIRYKDTLSQYGIDLILIIVISTLCVTLVTGLLTELLLKRKGSTQ 121
49478958   77 VIRYKDTLSQYGIDLILIIMISTLCVTLVTGLLTELLLKRKGSVQ 121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap