Conserved Protein Domain Family
PRK01631

?
PRK01631: PRK01631 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 167247
View PSSM: PRK01631
Aligned: 19 rows
Threshold Bit Score: 111.742
Threshold Setting Gi: 301053468
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30261931   1 MKNTLFRINELSKKEKATGLTVDEKQEQQMLRQNYTQTFRGSLDSILLNTKIVDQNGLNVTPAALQDAQIRLKLSK 76 
49184771   1 MKNTLFRINELSKKEKATGLTVDEKQEQQMLRQNYTQTFRGSLDSILLNTKIVDQNGLNVTPAALQDAQIRLKLSK 76 
47527191   1 MKNTLFRINELSKKEKATGLTVDEKQEQQMLRQNYTQTFRGSLDSILLNTKIVDQNGLNVTPAALQDAQIRLKLSK 76 
227815284  1 MKNTLFRINELSKKEKATGLTVDEKQEQQMLRQNYTQTFRGSLDSILLNTKIVDQNGLNVTPAALQDAQIRLKLSK 76 
229604563  1 MKNTLFRINELSKKEKATGLTVDEKQEQQMLRQNYTQTFRGSLDSILLNTKIVDQNGLNVTPAALQDAQIRLKLSK 76 
42781050   1 MKNILFRINELSKKEKVSGLTVDEKQEQQMLRQNYTQTFRGSLDSILLNTKIVDQNGHNVTPAALQDAQIRLKLSK 76 
30019969   1 MKNILFRINELSKKEKATGLTVDEKQEQQMLRQNYTETFRGSLDSILLNTKIVDQNGLNVTPAALQDAQIRLKLSK 76 
217959412  1 MKNILFRINELSKKEKVSGLTVDEKQEQQMLRQNYTQTFRGSLDSILLNTKIVDQNGLNVTPAALQDAQIRLKLSK 76 
301053468  1 MKNILFRINELLKKEKVSGLTVDEKQEQQMLRQNYTQTFRGSLDSILLNTKIVDQNGLNVTPAALQDAQIRLKLSK 76 
296502526  1 MKNILFRINELSKKEKANGLTVDEKQEQQMLRQNYTQTFRGSLDSILLNTKIVDQNGLNVTPAALQDAQIRLKLSK 76 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap