Conserved Protein Domain Family
PRK01533

?
PRK01533: PRK01533 
histidinol-phosphate aminotransferase; Validated
Statistics
?
PSSM-Id: 134568
View PSSM: PRK01533
Aligned: 19 rows
Threshold Bit Score: 757.266
Threshold Setting Gi: 30021056
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30262913    1 MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWLDHALYPDGGATTLRQTIANKLHVK 80 
42782052    1 MQVKDQLSSLQPYKPGKSPEQMKEVYGDHAFVKLASNENPFGCSPRVLDELQKSWLDHALYPDGGATTLRQTIANKLQVQ 80 
30021056    1 MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWLEHALYPDGGATTLRQIIADKLHVK 80 
222096445   1 MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWLDHALYPDGGATTLRQTIANKLHVQ 80 
218898024   1 MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLEELQKSWLEHSLYPDGGATTLRQTIADKLHVQ 80 
218233128   1 MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWLEHALYPDGGATTLRQTIADKLHVK 80 
217960390   1 MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWLDHALYPDGGATTLRQTIANKLHVQ 80 
225864920   1 MQVKDQLLSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWLDHALYPDGGATTLRQTIANKLHVQ 80 
301054463   1 MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKLWLDHALYPDGGATTLRQTIANKLHVQ 80 
296503479   1 MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSSRVLDELQKSWLEHALYPDGGATTLRQTIADKLHVK 80 
30262913   81 MEQVLCGSGLDEVIQMISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVKEVALNNGVYDLDEISSVVDNDTKIVWICNP 160
42782052   81 MEQVLCGSGLDEVIQIISRAALKAGDNIVTAGATFPQYRHHAIIEGCEVKEVPLNNGVYDLDEISSAVNNNTKIVWICNP 160
30021056   81 MEQVLCGSGLDEIIQIISRAVLRAGDNIVTAGATFPQYRHHAIIEGCEVKEVALNNGVYDLEEISSVVDNDTKIVWICNP 160
222096445  81 MEQVLCGSGLDEVIQIISRAVLKVGDNIVTAGATFPQYRHHAIIEGCEVKEVALNNGVYDLDEISSVVDNNTKIVWICNP 160
218898024  81 MEQVLCGSGLDEIIQIISRAVLRAGDNIVTAGATFPQYRHHAIIEGCEVKEIPLNKGVYDLDEISSAVNNNTKIVWICNP 160
218233128  81 MEQVLCGSGLDEIIQIISRAVLRAGDNIVTAGETFPQYRHHAIIEGCEVKEVALNNGVYDLEEISSVVDNDTKIVWICNP 160
217960390  81 MEQVLCGSGLDEVIQIISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVKEVALNNGVYDLDEISSVVDNNTKIVWICNP 160
225864920  81 MEQVLCGSGLDEVIQMISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVKEVALNNGVYDLDEISSVVDNNTKIVWICNP 160
301054463  81 MEQVLCGSGLDEVIQMISRAVLKAGDNIVTAGVTFPQYRHHAIIEGCEVKEVALNNGVYDLDEISSVVDNDTKIVWICNP 160
296503479  81 MEQVLCGSGLDEIIQIISRAVLRAGDNIVTAGATFPQYRHHAIIEGCEVKEIALNNGVYDLEEISSVVDNDTKIVWICNP 160
30262913  161 NNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGHEEL 240
42782052  161 NNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAIGQEEL 240
30021056  161 NNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGQEEL 240
222096445 161 NNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLQKHKNILVLRTFSKAYGLASFRVGYAIGQEEL 240
218898024 161 NNPTGTYVNEQKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLSLLEKHKNILVLRTFSKAYGLASFRVGYAIGQEEL 240
218233128 161 NNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGQEEL 240
217960390 161 NNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGHEEL 240
225864920 161 NNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGHEEL 240
301054463 161 NNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGHEEL 240
296503479 161 NNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGQEEL 240
30262913  241 IEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLRQYESFCKENEIPFYQSQTNFIFLPVENGGEIYEACAH 320
42782052  241 IEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLQQYESFCKENDIPFYPSQTNFIFLPVENAGEIYEACAH 320
30021056  241 IEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLQQYESFCRENDIPFYPSQTNFIFLPVENAREIYEACAH 320
222096445 241 IERLNVVRLPFNVSSLAQKAATIAFGDEEFIEEIVRVNTEGLQQYESFCKEHDIPFYPSQTNFIFLPVENAGEIYEACAH 320
218898024 241 IEKLNVVRLPFNVSSLAQKAATIAFSDDEFIKEIVRVNTEGLQQYESFCKENGIPFYSSQTNFIFLPVDNAGEIYEACAH 320
218233128 241 IEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLQQYESFCRENDIPFYPSQTNFIFLPVENAGEIYEACAH 320
217960390 241 IEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLRQYESFCKENEIPFYQSQTNFIFLPVENGGEIYEACAH 320
225864920 241 IEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLRQYESFCKENEIPFYQSQTNFIFLPVENGGEIYEACAH 320
301054463 241 IEKLNVVRLPFNVSSLAQKAAMIAFGDDKFIEEIVRVNTEGLQQYESFCKENEIAFYPSQTNFIFLPVENAGEIYESCAH 320
296503479 241 IEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLQQYESFCRENDIPFYPSQTNFIFLPVENAGEIYEACAH 320
30262913  321 AGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKSRDEANA 366
42782052  321 AGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKSRDEANA 366
30021056  321 AGFIIRPFPNGIRITVGTREQNEGVISVLQQHFENKKRKSRDEENA 366
222096445 321 AGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKSRDEANA 366
218898024 321 AGFIIRPFPNGVRITVGTREQNEGVISVLKQHFENKKSKSRDEANA 366
218233128 321 AGFIIRPFPNGIRITVGTREQNEGVISVLQQHFENKKRKSRDEENA 366
217960390 321 AGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKSRDEANA 366
225864920 321 AGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKSRDEANA 366
301054463 321 AGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKSRDEANV 366
296503479 321 AGFIIRPFPNGIRITVGIREQNEGVISVLQQHFENKKRKSRDEENA 366
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap