Conserved Protein Domain Family
PRK01530

?
PRK01530: PRK01530 
hypothetical protein; Reviewed
Statistics
?
PSSM-Id: 134567
View PSSM: PRK01530
Aligned: 15 rows
Threshold Bit Score: 120.301
Threshold Setting Gi: 148284889
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51474006    1 MNKFYIYNNFKNEALINIKVKPYSKQNLINNFVIINNIPYIKLSITAAPEQGKANEGIINYLAKEWKLSRSSIEIIKGHT 80 
157826313   1 MDKFYNYNSSLHQVLLNLKVKPNSKQNLISNFVIINNIPYLKLSIKATPEKGKANEEIINYLAKAWKLSRSNIEIIKGHT 80 
157804228   1 MDKFYNYNSSSNQALLNLKVKPDSKQNLISDFVIINNLPYLKLFIKTAPEQGKANEEIINYLAKAWKLSRSNIEIIKGHT 80 
91205448    1 -MKFFVYNPLLKTASLNIKVKAAAKSNDIKEFIIINDVLHLKLSIKAHAQQGKANEEIINFLAKEWQLLRSNLEITKGHT 79 
157827193   1 -MKFFVYNPLLKTASLNIKVKAAAKSNDIKEFIIINDVLHLKLSIKAHAQQGKANEEIINFLAKEWQLLRSNLEITKGHT 79 
229587206   1 MDKFYNYNSSSHQALLSFKVKPNSKQNLISNFVIINNIPYLKLSIKAIPEQGKANEEIINYLAKEWKLSRSNIEIIKGHT 80 
157964988   3 MDKFYNYNSSSHQALLSFKVKPNSKQNLISNFVIINNIPYLKLSIKAIPAQGKANEEIINYLAKEWKLSRSNIEIIKGHT 82 
162022116   1 MNKFYNYNSSSHQVLLNLKVKPNSKQNLISDFVIINNIPYLKLSIKATPEQGKANEEIINYLAKEWKLSRKDIEIIKGHT 80 
15893224    1 MDKFYNYNSSSHQALLSFKVKPNSKQNLISNFVIINNIPYLKLSIKAIPEQGKANEEIINYLAKEWKLSRSNIEIIKGHT 80 
15604669    1 MNKFYIYNSFKHEALINVKVKPYAKQNLIGNFVIINNIPYIKLAIKATPEQGKANEGIIHYLAKEWELSRSSIEIIKGHT 80 
51474006   81 HSLKTILIKNINEDYLNLIINSYIK 105
157826313  81 HSVKTILIKNINEDYLNFIINSYIR 105
157804228  81 HSLKTILIKNIDEDYLNSIINSYIK 105
91205448   80 NSLKTILIKNIDEEYLNLILKPYIK 104
157827193  80 NSLKTILIKNIDEEYLNLILKPYIK 104
229587206  81 HSLKTILIKNINEDYLNLIINSYIK 105
157964988  83 HSLKTILIKNINEDYLNLIINSYIK 107
162022116  81 NSLKTILIKNIDEDYLNLIINSYIK 105
15893224   81 HSLKTILIKNINEDYLNLIINSYIK 105
15604669   81 HSLKTILIKNINEDYLNLIINAYIK 105
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap