Conserved Protein Domain Family
rnpA

?
PRK01492: rnpA 
ribonuclease P protein component
Links
?
Statistics
?
PSSM-Id: 100883
View PSSM: PRK01492
Aligned: 13 rows
Threshold Bit Score: 155.821
Threshold Setting Gi: 157964752
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15604461    3 LCITSLKNQKEFELINKLGEKFYERYFILVIAKKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLMRIIVND 82 
51473789    1 MCITSLKNQKEFELINKLGQKFYERYFILVIAKKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLMRIIVND 80 
15892860    1 MSITSLKNQKEFELINKLGKKLHERYFILVIATKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLIRIIVSD 80 
67458739    1 MSITSLKNQKEFELINKLGKKFHERYFILVIAKKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLIRIIVSD 80 
91205682    1 MFITSLKNQKEFELINKLGKKFHEKYFILVIAKNIPKIFLESKYNIFLGIKVSKKLNKKAVVRNKIKRRIKHLIRLICNN 80 
157803528   1 MSITSLKNQKEFELINKLGKKFHERYFILVIAKNLPKIFLETKYNIFLGIKVSKKLNKKAVVRNKIKRRIRHLIRMNVSD 80 
157828791   1 MSITSLKNQKEFELINKLGKKLHERYFILVIATKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLIRIIVSD 80 
157964752   3 LSITSLKNQKEFELINKLGKKLHDRYFIVVIAKKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLIRIIVSD 82 
157826004   1 MSITSLKNQKEFELINKLGKKFHERYFILVIARNLPTIFLKSQYNTFLGIKVSRKLNKKAVIRNKIKRRIRHLVRIIVSD 80 
157826860   1 MFITSLKNQKEFELINKLGKKFHEKYFILVIAKNIPKIFLESKYNIFLGIKVSKKLNKKAVVRNKIKRRIKHLIRLICNN 80 
165933519   1 MSITSLKNQKEFELINKLGKKLHERYFILVIATKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLIRIIVSD 80 
229586954   1 MSITSLKNQKEFELINKLGKKLHERYFILVIATKLPKIFLESKYNTFLGIKVSRKLNKKAVVRNKIKRRIRHLIRIIVSD 80 
238650655   1 MSITSLKNQKEFELINKLGKKLHERYFILVIATKLPKIFLESKYNTFLGIKVSRKLSKKAVVRNKIKRRIRHLIRIIVSD 80 
15604461   83 SNFKAIKFAIIIIPKKGFEEINFSHLQYELSKIILRNI 120
51473789   81 SSVKAIKFAIIIIPRKGFEEINFSHLNYELSKIILRNI 118
15892860   81 SSFKAIKFAMIIIPRKGFEEINFSHLNYELSKVILRNI 118
67458739   81 SKLKAIKFAMIIIPRKGFEEINFSHLNCELSKIILRNI 118
91205682   81 SNLK--KLAMIIIPRKGFDTADFSVLNHELSKAILDFY 116
157803528  81 SKLKAIKLAMIIIPRKGFEEINFSHLNDELSNIILKNI 118
157828791  81 SSFKDIKFAMIIIPRKGFEEINFSHLNYELSKLILRNI 118
157964752  83 SSFKAIKFAMIIIPRKGFEEIHFSHLNYELSKVILRNI 120
157826004  81 AKLSAVKFAMIIIPRKGFEEINFSHLNYELSKIVLRNI 118
157826860  81 SNLK--KLAMIIIPRKGFDTADFSVLNHELSKAILDFY 116
165933519  81 SSFKDIKFAMIIIPRKGFEEINFSHLNYELSKLILRNI 118
229586954  81 SSFKAIKFAMIIIPRKGFEEINFSHLNYELSKVILRNI 118
238650655  81 SSFKAIKFAMIIIPRKGFEEINFSHLNYELSKVILRNM 118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap