Conserved Protein Domain Family
fliE

?
PRK01482: fliE 
flagellar hook-basal body complex protein FliE
Statistics
?
PSSM-Id: 134562
View PSSM: PRK01482
Aligned: 11 rows
Threshold Bit Score: 126.074
Threshold Setting Gi: 42526723
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42526723    1 MVNAVNVANVNSVpglldvpKINAVVTDnfrakmVSNTDMIELAANKEAASFEQTILKAFDSMNAKQTNMDKLGEQMIVD 80 
15594637    4 TDAFFTENNINLV-------KKNPLHFD------VNLFSSKSNAKDNDIKTFKDVLINSITDVNKSQLNVSKVTEQAILK 70 
218249375   4 TDAFFTENNINLV-------KKNPLHFD------VNLFSSKSNAKDNDIKTFKDVLINSITDVNKSQLNVSKVTEQAILK 70 
187918166   3 VDSFFTDNDVYLI-------RKNPLHFG-------RSSSGFDVKREEKDKTFKDLFFNLMSDVNNSQLDVSKMSQQAILK 68 
119953091   3 VDSFFTDNNVYLV-------RKNPLHFD-------KSFSVFDVKREVKAESFKDLFLNLISDVNNSQLDVSRMSQQAILQ 68 
111115117   4 IDAFFTENNINLV-------KKNPLHFD------VNLFSSKNTAKNNDIKTFKDVLINTITDVNKSQLNVPKVMEQAIFR 70 
203284213   3 VDSFFTDSNVYLI-------RKNPLHFD-------KSFSDFSVKSEKQAGTFRELFLNLISNVNNSQLDMYKVSQQAILH 68 
203287752   3 VDSFFTDSNVYLI-------RKNPLHFD-------KSFSDFSVKSEKQAGTFRELFLNLISNVNNSQLDMYKVSQQAILH 68 
51598552    4 IDAFFTENNINLI-------KKNPLHLD------VNFFSSKSSTKNNDAKTFKDVLINTITDINKSQLNVSKVMEQVVLS 70 
15639389    4 VGTITNSANVYKVpslrkvpEIGPVSVEsvrqrmRGNTDAVDQAVNKKAMSFEQTLLRAFDQVNQKQQKTAELTEQMIVD 83 
189025631   4 VGTITNSANVYKVpslrkvpEIGPVSVEsvrqrmRGNTDAVDQAVNKKAMSFEQTLLRAFDQVNQKQQKTAELTEQMIVD 83 
42526723   81 PESVDVHDITMGMAEASLSLKLAQTIIDRLVKTWNDITTTR 121
15594637   71 PSSIDVHDVVIAMSKANMNLSILKAVVERGVKAYQDIINIR 111
218249375  71 PSSIDVHDVVIAMSKANMNLSILKAVVERGVKAYQDIINIR 111
187918166  69 PNDIDVHDIVISMSKANMNLSITKAIVEKSIKAYQDIINIR 109
119953091  69 PNSVDVHDITIAMAKANMNLSITKAVVERSIKAYQDVINIR 109
111115117  71 PSSIDVHDFVIAMSKANMNLSILKAVVERGVKAYQDIINIR 111
203284213  69 PDSVDVHDVVISMAKANMNLSITKAVVEKSIKAYQDVINIR 109
203287752  69 PDSVDVHDVVISMAKANMNLSITKAVVEKSIKAYQDVINIR 109
51598552   71 PSSVDVHDFAIALSKANMNLSILKAVVERGIKAYQDIINIR 111
15639389   84 PESVDVHDVTVAMAEASMSLKIAQTVIDKVLKSWNDVTTAR 124
189025631  84 PESVDVHDVTVAMAEASMSLKIAQTVIDKVLKSWNDVTTAR 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap