Conserved Protein Domain Family
atpC

?
PRK01474: atpC 
F0F1 ATP synthase subunit epsilon; Validated
Statistics
?
PSSM-Id: 100879
View PSSM: PRK01474
Aligned: 13 rows
Threshold Bit Score: 177.372
Threshold Setting Gi: 91204912
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15893157    1 MNATILVKIITPLSIALEKQAKMVTMSGEEGMFGVLPSHVPMIVSLKAGLVQVYIDDMHKSENTYLISGGVTEVTANYIN 80 
15604632    1 MHETIRVKIITPSSIAFEKQSKMVTMPGEDGMFGVLPHHVPMIVNLKAGLVQIYIYNIHNYENTYLISGGVTEITSHYIN 80 
157829066   1 MNATILVKIITPLSIALEKQAKIVTMSGEEGMFGVLPSHVPMIVSLKAGLVQVYIDDMHKSENTYLISGGVTEVTANYIN 80 
165933792   1 MNATILVKIITPLSIALEKQAKIVTMSGEEGMFGVLPSHVPMIVSLKAGLVQVYIDDMHKSENTYLISGGVTEVTANYIN 80 
161610763   1 MNETIQVKIITPSSIAFEKQSKMVTMPGEDGMFGVLPNHVPMIVNLTAGLVQVYINNMHNSENTYLISGGVTEITSNYIN 80 
157826256   1 MNETILVKIITPLSIALERQAKMVTIPGEDGMFGVLSNHATMIVSLKAGLVQVYIDDIYNPQITYLVSSGVTEVTGSYVN 80 
157804172   1 MNETIIVKIITPLSIAFEKQAKMVTLPGDDGMFGVLPSHTPMLVSLKTGLVQVYIDDMHKPKNTYLISGGVTEVAGSYIN 80 
91204912    1 MSETINVKIITPLNIVFEEQAKMITLPGEEGEFGVLQGHAPMIVSLKAGLLKVYIDDMHKPKITYLIANGVTEVTGSYIN 80 
157827762   1 MSETINVKIITPLNIVFEEQAKMITLPGEEGEFGVLQGHAPMIVSLKAGLLKVYIDDMHKPKITYLIANGVTEVTGSYIN 80 
229587162   1 MNATILVKIITPLSIALEKQAKMVTMSGEEGMFGVLPSHVPMIVSLKAGLVQVYIDDMHKSENTYLISSGVTEVTANYIN 80 
157964948   7 MNATILVKIITPLSIAFEKQAKMVTMPGEEGMFGVLPSHVLMIVSLKAGLVQVYIDDMHESENTYLISGGVTKVTANYIN 86 
67459657    1 MNETILVKIITPLSIAFEKQAKMVTMPGEEGMFGVLPNHAPMIVSLKAGLVQVYIDDIYNPQITYLVSSGVTEVTGSYVN 80 
238650820   1 MNATILVKIITPLSIALEKQAKMVTMSGEEGMFGVLPSHVPMIVSLKAGLVQVYIDDMHKSENTYLISGGVTEVTANYIN 80 
15893157   81 IATETAINVTNLSEVEIATKLLDLQKTLSDQH 112
15604632   81 IVTEVAINVTNLSESEISTQRYELQKLLSHQH 112
157829066  81 IATETAINVTNLSEAEIATKLLDLQKTLSDQH 112
165933792  81 IATETAINVTNLSEAEIATKLLDLQKTLSDQH 112
161610763  81 IVTEAAINVTNLSESEISTQCYELQKLSSH-- 110
157826256  81 IATETAINVTNLSEAEIATKLQGLQKPLSEQH 112
157804172  81 IATEIAINVTNLSEAEIATKLLDL-------- 104
91204912   81 IATETAINITDLSEAEIENKLTALQKSI---- 108
157827762  81 IATETAINITDLSEAEIENKLTALQKSI---- 108
229587162  81 IATETAINVTNFSEAEIATKLLDLQKTLSDQH 112
157964948  87 IATETAINVTNLSEAEIATKLLDL-------- 110
67459657   81 IATETAINVTNLNEAEIATKLLELQKPLSEQH 112
238650820  81 IATDTAINVTNLSEAEIATKLLDLQKTLSDQH 112
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap