Conserved Protein Domain Family
PRK01441

?
PRK01441: PRK01441 
Maf-like protein; Reviewed
Statistics
?
PSSM-Id: 167232
View PSSM: PRK01441
Aligned: 36 rows
Threshold Bit Score: 372.126
Threshold Setting Gi: 15887881
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82699181    1 MNVQHKLVLASGSPRRIELLGQAGIEPDRIHPADIDETPQRAEHPRSLARRLSRDKARKAHEQLQGEAGFSGALVLAADT 80 
222087234   1 MALKHKLILASGSPRRVDLLHQAGIEAARLMPMDIDEAPKKSEHPRSLARRLSAEKGEAAFAAVKGDVAWQGSYILAADT 80 
227820810   1 MTVTQKLILASGSPRRVELLAQAGIEPARLLPMDLDETPKRAEHPRSLARRLSAEKAKAALAAVKGEPSWDGSYILAADT 80 
241203025   1 MALKYKLILASGSPRRVDLLNQAGIEPSRLMPMDIDEAPKKSEHPRSLARRLSAEKAEAALAAIKGDITWKGSYILSADT 80 
209547852   1 MALKYKLILASGSPRRVDLLNQAGIEPSRLMPMDIDETPKKSEHPRSLARRLSAEKAEAALAAIKSDITWKGSYILSADT 80 
116250389   1 MALKYKLILASGSPRRVDLLNQAGIEPSRLMPMDIDEAPKKSEHPRSLARRLSAEKAEAALAAIKGDITWKGSYILSADT 80 
86356237    1 MALKYKLILASGSPRRVDLLNQAGIEPSRLMPMDIDETPKKSEHPRSLARRLSAEKAEAALAAIKGDITWKGSYILSADT 80 
190890286   1 MALKYKLILASGSPRRVDLLNQAGIEPSRLMPMDIDETPKKSEHPRSLARRLSAEKAEAALAAIKGDITWKGSYILSADT 80 
15964368    1 MAVTKKLILASGSPRRVELLAQAGIEPARLMPMDLDETPKRSEHPRSLARRLSAEKAKAALSAITGDPAWDGSYILAADT 80 
150395439  16 MAVTKKLILASGSPRRVELLAQSGIEPARLMPMDLDETPKRSEHPRSLARRLSAEKAKAALSAITGDPAWEGSYILAADT 95 
82699181   81 VVAVGRRILPKAEIEDEARECLRLLSGRTHKVFTGVCLVLPNGNLRQTLVETRLRFERLSRLQINAYLSSGEWRGKAGGY 160
222087234  81 VVAVGRRILPKAEFVDEASSALHLLSGRSHVVYTGVCLITPDRKLRQKVIETKVRFKRLSARDIDMYLASGQWRGKAGAY 160
227820810  81 VVCVGRRILPKPELVSEASSALHLLSGRSHRVYTGICLVTPDRTIRQKVVDTKVRFKRLSGLDIETYLASGQWRGKAGGY 160
241203025  81 VVAVGRRILGKAEFADEALSSLHLLSGRNHMVYTGVCLVTPDRKIRQKIVETKVRFKRLSGFEIENYLASGQWRGKAGAY 160
209547852  81 VVAVGRRILGKAEFADEALSSLHLLSGRNHLVYTGVCLVTPDRKIRQKIVETKVRFKRLSGFEIENYLASGQWRGKAGAY 160
116250389  81 VVAVGRRILGKAEFADEALNSLHLLSGRNHMVYTGVCLVTPDRKVRQKIVETKVRFKRLSGFEIENYLASGQWRGKAGAY 160
86356237   81 VVAVGRRILGKAEFADEALSSLHLLSGRNHLVYTGICLVTPDRKIRQKIVETKVRFKRLSGFEIENYLASGQWRGKAGAY 160
190890286  81 VVAVGRRILGKAEFADEALSSLHLLSGRNHLVYTGVCLVTPDRKIRQKIVETKVRFKRLSGFEIENYLASGQWRGKAGAY 160
15964368   81 VVCVGRRILPKPELVSEASSALHLLSGRSHRVYTGICLVTPDRTLRQKVIDTKVRFKRLSTLDIESYLASGQWRGKAGGY 160
150395439  96 VVCVGRRILPKPELVSEASAALHLLSGRSHRVYTGICLVTPDRTLRQKVIDTKVRFKRLSTMDIESYLASGQWRGKAGAY 175
82699181  161 AIQGLAGSFVVKLVGSYTNVVGLPLQETVGLLADGGYPVYANWGTG 206
222087234 161 GIQGLAGSFVQKLIGSYTNVVGLPLYETMLLLAGEGFDVHATWQEG 206
227820810 161 GIQGIAGSFVVKLVGSYTNVVGLPLYETVNLLIGEGYDVHGRWLEG 206
241203025 161 GIQGLAGTFVQKMVGSYTNVVGLPLYETILLLTGEGFDVHSRWPEG 206
209547852 161 GIQGLAGTFVQKMVGSYTNVVGLPLYETIVLLTGEGFDVHSRWPEG 206
116250389 161 GIQGLAGTFVQKMVGSYTNVVGLPLYETILLLTGEGFDVHSRWPEG 206
86356237  161 GIQGLAGTFVQKMVGSYTNVVGLPLYETILLLTGEGFDVHSRWPEG 206
190890286 161 GIQGLAGTFVQKMVGSYTNVVGLPLYETIVLLTGEGFDVHSRWPEA 206
15964368  161 GIQGIAGGFVVKLVGSYTNVVGLPLYETVNLLVGEGYDVHDRWLEG 206
150395439 176 GIQGIAGSFVVKLVGSYTNVVGLPLYETVNLLVGEGYDVHDRWLEG 221
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap