Conserved Protein Domain Family
PRK01415

?
PRK01415: PRK01415 
hypothetical protein; Validated
Statistics
?
PSSM-Id: 167229
View PSSM: PRK01415
Aligned: 12 rows
Threshold Bit Score: 505.248
Threshold Setting Gi: 91205984
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15604002    1 MNERITILSAYSFVNIIEPANLIPKLLLVGKKKYIRGTILLANEGFNSSFSGSYENVNIVLKQLIALTGSKDVNVKINYS 80 
51473325    1 MNERIAILSAYSFVNIIEPANLIPKFLLIGKKKYIRGTILLANEGFNCSFSGSYENVNLVLKQLIELTGSKDVNVKINYS 80 
15892090    1 MNEKIAILSAYSFVNIEEPANLIPKLLLIGKRKYVRGTILLANEGFNGSFSGSYENVNLVLEELIKLTGPKDVNVKINYS 80 
91205984    1 MSEKIAILSAYSFVNIEEPESLIPKLLFVGKRKYVKGTILLSKEGFNGSFSGSYESVNLVLEELKKLTNTKDVNVKINCS 80 
157828040   1 MNEKIAILSAYSFVNIEEPANLIPKLLLLGKRKYIRGTILLANEGFNGSFSGSYENVNLVLEELIKLTGPKDVNVKINYS 80 
157826652   1 MSEKIAILSAYSFVNIEEPESLIPKLLFVGKRKYVKGTILLSKEGFNGSFSGSYESVNLVLEELKKLTNTKDVNVKINYS 80 
157825303   1 MSEKIAILSAYSFVNIEEPANLIPKLLLIGKRKYVRGTILLANEGFNGSFSGSYENVNLVLEELIKLTGPKDVNVKINYS 80 
165932738   1 MNEKIAILSAYSFVNIEEPANLIPKLLLLGKRKYIRGTILLANEGFNGSFSGSYENVNLVLEELIKLTGPKDVNVKINYS 80 
157803311   1 MNEKIAILSTYSFVNIEEPANLIPKLLLIAKRKYVRGTILLSKEGFNGSFSGSYENVNLVLEELIKLTVPKDVNVKINYS 80 
157964192   1 MNEKIAILSAYSFVNIEEPANLIPKLLLIGKRKYVRGTILLANEGFNGSFSGSYENVNLVLEELIKLTGPKDVNVKINYS 80 
229586365   1 MNEKIAILSAYSFVNIEEPANLIPKLLLIGKRKYVRGTILLANEGFNGSFSGSYENVNLVLEELIKLTGPKDVNVKINYS 80 
238650699   1 MNEKIAILSTYSFVNIEEPANLIPKLLLIGKRKYIRGTILLANEGFNGSFSGSYENVNLVLEELIKLTGPKDVNVKINYS 80 
15604002   81 PVHPFQKLKVRLKREIIAMNVKDLNVDVFKGHYIEPKDWDEFITKQNVILIDTRNEYEIDIGTFKSAINPRTETFKQFPA 160
51473325   81 SVHPFQKLKVRLKKEIIAMNVKDLNIEVFKGDYIEPKDWDEFITKQNVIVIDTRNEYEIDIGTFKSAINPRTETFKQFPA 160
15892090   81 DVHPFQKLKVRLKKEIVAMNVDGLNVDLFKGEYIEPKDWDEFITQQDVIVIDTRNDYEVEVGTFKSAINPNTKTFKQFPA 160
91205984   81 EIHPFQKLKVRLKKEIVAMNVDNLNVNLFKGEYIETKDWDEFITKQDVI-VDTRNDYEVEVGTFKAAINPYTETFKQFPA 159
157828040  81 DVHPFQKLKVRLKKEIIAMNVDDLNVDLFKGEYIEPKDWDEFITKQDVIVIDTRNDYEVEVGTFKSAINPNTKTFKQFPA 160
157826652  81 EIHPFQKLKVRLKKEIVAMNVDNLNVNLFKGEYIETKDWDEFITKQDVIVVDTRNDYEVEVGTFKAAINPYTETFKQFPA 160
157825303  81 DVHPFQKLKVRLKKEIVAMNVEGLNVDLFKGEYIEPKDWDEFITKQNVIVIDTRNDYEVEVGTFKSAISPNTKTFKQFPA 160
165932738  81 DVHPFQKLKVRLKKEIIAMNVDDLNVDLFKGEYIEPKDWDEFITKQDVIVIDTRNDYEVEVGTFKSAINPNTKTFKQFPA 160
157803311  81 DLHPFQKLKVRLKKEIVAMNVDDLNVDLFKGEYIESKDWDSFITKQDVIVIDTRNDYEVEIGTFKSAINPYTKTFKQFPA 160
157964192  81 DVHPFQKLKVRLKKEIVAMNVDDLNVDLFKGEYIEPKDWDEFITKQDVIVIDTRNDYEVEVGTFKSAINPNTKTFKQFPA 160
229586365  81 DVHPFQKLKVRLKKEIVAMNVDGLNVDLFKGEYIEPKDWDEFITKQDVIVIDTRNDYEVEVGTFKSAVNPNTKTFKQFPA 160
238650699  81 DVHPFQKLKVRLKKEIVAMNVDDLNVDLFKGEYIEPKDWDEFITKQDVIVIDTRNDYEVEVGTFKSAINPNTKTFKQFPA 160
15604002  161 WVQQNHALLQGKKIAMFCTGGIRCEKSTSLLKSIGYNEVYHLKGGILQYLEDTHNKNNLWQGKCFVFDDRRAVADDLYPA 240
51473325  161 WVQQNQALLQGKKIAMFCTGGIRCEKSTSLLKSIGYNEVYHLKGGILQYLEDTHNKNNLWQGKCFVFDDRRAIMDDLSPA 240
15892090  161 WVQQNQELLKGKKIAMVCTGGIRCEKSTSLLKSIGYDEVYHLKGGILQYLEDTQNKNNLWQGECFVFDDRRAVTDDLSPV 240
91205984  160 WVEQNAELLKGKKIAMFCTGGIRCEKSTSLLKSMGHEEVYHLKGGILQYLEDTQNKNNLWQGECFVFDDRRAVADDLAPA 239
157828040 161 WVQQNQELLKGKKIAMVCTGGIRCEKSTSLLKSIGYNEVYHLKGGILQYLEDTQNKNNLWQGECFVFDDRRAVTDDLSPV 240
157826652 161 WAEQNAELLKGKKIAMFCTGGIRCEKSTSLLKSMGHEEVYHLKGGILQYLEDTQNKNNLWQGECFVFDDRRAVADDLAPA 240
157825303 161 WVQKNQGLLKGKRIAMVCTGGIRCEKSTSLLKSIGYDEVYHLKGGILQYLEDTQNKNNLWQGACFVFDDRRAVADDLSPV 240
165932738 161 WVQQNQELLKGKKIAMVCTGGIRCEKSTSLLKSIGYNEVYHLKGGILQYLEDTQNKNNLWQGECFVFDDRRAVTDDLSPV 240
157803311 161 WVHQNEKLLKGKKIAMFCTGGIRCEKSTSLLKSIGYDDVYHLKGGILQYLEDTQNKNNLWQGECFVFDDRRAVEDDLSPS 240
157964192 161 WVQQNQELLKGKKIAMVCTGGIRCEKSTSLLKSIGYDEVYHLKGGILQYLEDTQNKNNLWQGECFVFDDRRAVTDDLSPV 240
229586365 161 WVQQNQELLKGKKIAMVCTGGIRCEKSTSLLKSIGYDEVYHLKGGILQYLEDTQNKNNLWQGECFVFDDRRAVTDDLSPV 240
238650699 161 WVQQNQELLKGKKIAMVCTGGIRCEKSTSLLKSIGYDEVYHLKGGILQYLEDTQNKNNLWQGECFVFDDRRAVTDDLSPV 240
15604002  241 EGYWLHR 247
51473325  241 EGYWLHR 247
15892090  241 ERHWLQR 247
91205984  240 EGYWLER 246
157828040 241 ERHWLQR 247
157826652 241 EGYWLER 247
157825303 241 AGHWLQR 247
165932738 241 ERHWLQR 247
157803311 241 ERHTRLP 247
157964192 241 ERHWLQR 247
229586365 241 ERHWLQR 247
238650699 241 ERHWLQR 247
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap