Conserved Protein Domain Family
cyaY

?
PRK01379: cyaY 
iron donor protein CyaY
Links
?
Statistics
?
PSSM-Id: 134546
View PSSM: PRK01379
Aligned: 13 rows
Threshold Bit Score: 177.819
Threshold Setting Gi: 91205624
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15892366    1 MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYHFFYEQGEWTN 80 
15604191    1 MNNTAFSKLAETTIVYIVDKIEEQDLEGIIDVDLQGDILNLDTENGIYVINTQSASKEIWLSSPVSGPHHFFYEQGKWKS 80 
157828316   1 MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYHFFYEQGKWTN 80 
165933025   1 MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYHFFYEQGKWTN 80 
51473518   10 MNNTAFSKLAETTIVYIVDKIEEQDIEGIIDVDLHGDILNLDTENGIYVINTQSASKEIWLSSPVSGPHHFFYEQGKWKS 89 
157825568   1 MNNTEFSKIADITIAYITDTIEEQDKEASIDVDLQGDILNLDTDKGIYVINKQSAAKEIWLSSPVSGPCHFFYEQGKWKN 80 
157803942  10 MNNAEFSKIAETTIAYIVEKIEEQDKEASIDVDLQGDILNLDTDKGIYVINKQSAAKEIWLSSPVSGPYHFFYEQGKWRN 89 
91205624    1 MNNSEFSKIAETVIAHIADRIEEQNQD--IDVDLQSDILSIDTTDGIYVINKQSAAKEIWLSSPVSGPYHFFYEQGKWKN 78 
157827337   1 MNNSEFSKIAETVIAHIADRIEEQNQD--IDVDLQSDILSIDTTDGIYVINKQSAAKEIWLSSPVSGPYHFFYEQGKWKN 78 
229586587   1 MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYHFFYEQGEWTN 80 
157964401  10 MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYIINKQSAAKEIWLSSPVSGPYHFFYAQGEWTN 89 
67458914    1 MNNTEFSKIAETTIAYIADKIEEQDKEASIDVDLQGDILNLDTDKGIYVINKQSAAKEIWLSSPVSGPYHFFYEQGKWKN 80 
238650773   1 MNNSEFSKIAETTIAYIAEKIEEQDKEASIDVDLQGDILNLDTDKGVYVINKQSAAKEIWLSSPVSGPYHFCYEQGKWTN 80 
15892366   81 RAGLELMAILTEELNIKFDTRPT 103
15604191   81 RIGFELMVLLTEELGIRFDKYEI 103
157828316  81 RAGLELMAILTEELNIKFDTRPT 103
165933025  81 RAGLELMAILTEELNIKFDTRPT 103
51473518   90 RIGFELMILLTEELGIRFDKCEI 112
157825568  81 RVGLELMAILTEELDIDFNNV-- 101
157803942  90 RAGLELIIILADELGIDFSNIK- 111
91205624   79 RAGLELMSILTDELGIDF----- 96 
157827337  79 RAGLELMSILTDELGIDF----- 96 
229586587  81 RAGLELMAILTEELNIKFDTRPT 103
157964401  90 RAGLELMAILTEELNIKFDTRPT 112
67458914   81 KIGLELMAILTEELNIKFDNI-- 101
238650773  81 RAGLELMAILTEELNIKFDTRPT 103
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap