Conserved Protein Domain Family
hscB

?
PRK01356: hscB 
co-chaperone HscB; Provisional
Statistics
?
PSSM-Id: 167217
View PSSM: PRK01356
Aligned: 15 rows
Threshold Bit Score: 228.608
Threshold Setting Gi: 91205327
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51473400    1 MQNYFQLLELPQEYNIDLKILEKQYFAMQIKYHPDKAKTVQEKEQNLIIATELNKAYSTLKDALKRAEYMLLLQNINLND 80 
157803393   1 MQNYFQLLGLQQDYNIDLKILEKQYFAMQVKYHPDKAKTLQEKEQNLIIAAELNKAYSTLKDALKRAEYMLLLQNINLND 80 
91205327    1 MQNYFELLGLEQIYNIDLKILEKQYFAMQIKYHPDKAKNLQEKEQNLIIASNLNKAYYTLKDSLKRAEYMLLLYGVNLND 80 
157826930   1 MQNYFELLGLEQIYNIDLKILEKQYFAMQIKYHPDKAKNLQEKEQNLIIASNLNKAYSTLKDSLKRAEYMLLLYGVNLND 80 
229586445   1 MQNYFQLLGLPQEYNINLKILEKQYFAMQVKYHPDKAKTLQEKEQNLITAAELNNAYSTLKDALKRAEYMLLLQNINLND 80 
157964266   1 MQNYFQLLGLPQEYNINLKILEKQYFAMQVKYHPDKAKTLQEKEQNLITAAELNNAYSTLKDALKRAEYMLLLQKINLND 80 
15892186    1 MQNYFQLLGLPQEYNINLKILEKQYFAMQVKYHPDKAKTLQEKEQNLITAAELNNAYSTLKDALKRAEYMLLLQNINLND 80 
161729089   1 MQNYFQLLELPQEYNIDLKILEKQYFAMQVKYHPDTAKTAQEKAQNLITSTELNKAYSTLKDALKRAEYMLLLQNINLND 80 
157828141   1 MQNYFQLLGLPQEYNINLKILEKQYFAMQVKYHPDKAKTLQEKEQNLITAAELNNAYSTLKDALKRAEYMLLLQNINLND 80 
165932841   1 MQNYFQLLGLPQEYNINLKILEKQYFAMQVKYHPDKAKTLQEKEQNLITAAELNNAYSTLKDALKRAEYMLLLQNINLND 80 
51473400   81 EKIRSLLSPLELSIFWNEMERIENTILFSDLEKIKHKYELMQQQNINSLKQAFEKRNLSDATIHTSKLKYIRTLQNKLQE 160
157803393  81 QKARTLLSSLELSIFWDEMEIIENTTICSDLEKIKAKYELMEKHEIDSLKQAFEEQNLSDATIKTSKLKYIGTLLNKLQK 160
91205327   81 EKVRSKLSALELSIFWDEMELIENTSSYKSLEEIKSKYELMEKAEVNFLAESFKKQDLSDATIKTSKLKYIHTLLSKLQE 160
157826930  81 EKVRSKLSALELSIFWDEMELIENTSSYKSLEEIKSKYELMEKAEVNFLAESFKKQDLSDATIKTSKLKYIHTLLSKLQE 160
229586445  81 EKTRSLLSPLELSIFWDEMEIIENTILFSDLEKIKDKYELMKKLEIDSLKQAFEEQNLLDATIKTSKLKYIGTLLHKLQE 160
157964266  81 EKTRSLLSPLELSIFWDEMEIIENTILFSDLEKIKDKYELMKKLEIDSLKQAFEEQNLSDATIKTSKLKYIRTLLHKLQE 160
15892186   81 EKTRSLLSPLELSIFWDEMEIIENTILFSDLEKIKDKYELMKKLEIDSLKQAFEEQNLSDATIKTSKLKYIGTLLHKLQE 160
161729089  81 EKIRSLLSPLELSIFWDEMERIENTTLFSDLEKLKNKYELMQQQNINSLKQAFVEQNLSDATIYTSKLKYIRTLQSKLQE 160
157828141  81 EKTRSLLSPLELSIFWDEMEIIENTILFSDLEKIKDKYELMKKLEIDALKQAFEEQNLSDATIKTSKLKYIGTLLHKLQE 160
165932841  81 EKTRSLLSPLELSIFWDEMEIIENTILFSDLEKIKDKYELMKKLEIDALKQAFEEQNLSDATIKTSKLKYIGTLLHKLQE 160
51473400  161 KIKSCK 166
157803393 161 KIKSCK 166
91205327  161 KMKLCK 166
157826930 161 KMKLCK 166
229586445 161 KIKSCK 166
157964266 161 KIKSCK 166
15892186  161 KIKSCK 166
161729089 161 KIKSCK 166
157828141 161 KIKSCK 166
165932841 161 KIKSCK 166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap