Conserved Protein Domain Family
PRK01310

?
PRK01310: PRK01310 
hypothetical protein; Validated
Statistics
?
PSSM-Id: 167208
View PSSM: PRK01310
Aligned: 22 rows
Threshold Bit Score: 134.017
Threshold Setting Gi: 110635561
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222087485   1 MNGAWQAFADHVRLSVRLTPNGGRDAVDGIETGADGEAYLKARVSAVPEKGKANKALIALLAKRLSIPKSSLSLISGDTA 80 
222150063   1 MSHCYRRFDDHIRLAVRLTPNGGRDGIDGVDVNANGEAHLKVRVSDVPEKGRANKALIALLAKRLGVAKSAVSLISGDAA 80 
27375661    1 -----------------MTPRGGRDDIDGIEQLADGRSVLKVRVRAIADGGEANKAVLVLLAKSLGVPKASVRLLSGATS 63 
227823716   2 ARAALTGFGDHLRLTVRLTPNGGRDAIDGFEIAADGEEHLKVRVRAVPEKGKANDALIGLLAKAFGLAKNRIALVSGDTQ 81 
86359493   10 LSPPWKLFADHLRLTVRLTPNGGRDAFDGIDTDSEGETYLGARVTAVPEKGKANKALIALVSKSVGVAKSSVSVISGETA 89 
190893761   1 MSPPWKLFADHLRLTVRLTPNGGRDAFDGIETGSEGETYLKARVTAIPEKGKANKALIALVSKSLGVAKSSITLVSGETA 80 
241206712   1 MSRPWSLFDDHLRLAVRLTPNGGRDALDGIEADGEGEAFLKARVTAVPEKGKANKALILLIAQSLRIPKSSVSLISGDTA 80 
209551279   1 MNRPWKKSDDHVRLAIRLTPNGGRDAIDGAETDGEGEAYLKTRVTTVPEKGKANKALILLIAKSLGIAKSSVSLVSGDTA 80 
116254232   1 MSSPWSLFDDHLRLAVRLTPNGGRDALDGIEADGEGEAFLKARVTAVPEKGKANKALMLLIAKSLRIPKSSVSLVSGETA 80 
90421586    1 MTEAWRYSAQGISVALRVTPRGGRDDIDGLETLANGRTVVKVRVRAIAEGGEANRAVTELLAKALGVPKRAVRVLSGTTS 80 
222087485  81 RKKILRIDGDPEDLIGRLKAIVKD 104
222150063  81 RQKILRIDGDPEDLIGRLETITAE 104
27375661   64 RLKQIAVDGDPARLGETLRQLASA 87 
227823716  82 RKKILRIEADPEAIQKRLTEIVGE 105
86359493   90 RKKILRIEGDPEDLARKLEVFLE- 112
190893761  81 RKKILRIEGDPEDLAKKLETLSG- 103
241206712  81 RKKILRIDGDPEDLVKKLEIFLG- 103
209551279  81 RKKILRIDGDPEDLGKKLETLLG- 103
116254232  81 RKKILRIDGDPEDLVKKLEIFLG- 103
90421586   81 RLKQVAVDGDPNELGEALRKLTAP 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap