Conserved Protein Domain Family
PRK01295

?
PRK01295: PRK01295 
phosphoglyceromutase; Provisional
Statistics
?
PSSM-Id: 167205
View PSSM: PRK01295
Aligned: 49 rows
Threshold Bit Score: 400.989
Threshold Setting Gi: 154254001
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
158421780   1 MDRLLVLVRHGQSEWNLKNLFTGWRDPNLTDQGVSEARRAGALLAAEGLSFDVAYTSALTRAQRTCQLVLEEMGLTGLRT 80 
222084415   1 MSGTLVLVRHGQSDWNLKNLFTGWKDPDLTALGVEEAKTGGKALADYGIKYDIAFTSVLTRAQHTLKIILDEVGQPGLET 80 
227823993   1 MSGTLVLVRHGQSEWNLKNLFTGWRDPDLTELGVEEAKAGGAALAEYGIKFDIAFTSVLVRAQRTCQMVLDAVGQSSLET 80 
241207121   1 MSGTLVLVRHGQSDWNLKNLFTGWKDPDLTELGVQEANAGGAALAEYGIKFDVAYTSVLVRAQHTLKLILDKVGQPDLQT 80 
209551697   1 MSGTLVLVRHGQSDWNLKNLFTGWKDPDLTALGIEEANAGGKALAEYGIKFDIAYTSVLVRAQHTLKLILDKVGQPDLPT 80 
116249946   1 MSGTLVLVRHGQSDWNLKNLFTGWKDPDLTELGIQEANTGGAALAEYGIKFDVAYTSVLVRAQHTLKLILDKVGQPDLLT 80 
86355829    1 MSGTLVLVRHGQSDWNLKNLFTGWKDPDLTELGIQEANAGGVALAEYGIKFDVAYTSALVRAQHTLKLVLDKVGQPDLET 80 
190889845   1 MSGTLVLVRHGQSDWNLKNLFTGWKDPDLTELGIQEANAGGAALAEYGIKFDVAYTSALVRAQHTLKLILDKVGQPDLQT 80 
150398561   1 MSGTLVLVRHGQSDWNLKNLFTGWRDPDLTELGIEEAMAGGKALADYGIKFDIAFTSDLIRAQRTCQLVLDAVDQSSLET 80 
15963915    1 MSGTLVLVRHGQSDWNLKNLFTGWRDPDLTELGIEEAKAGGKALADYGIKFDIAFTSVLIRAQRTCQLVLDAVGQSSLET 80 
158421780  81 IADQALNERDYGDLSGLNKDDARAKFGEEQVHVWRRSYDISPPGGESLRDTVARVLPYFVQEILPSVLRGERTLVAAHGN 160
222084415  81 IKDQALNERDYGDLSGLNKDDARAKWGEEQVHIWRRSYDVPPPGGESLRDTGARVWPYYLTEILPRVLAGQKVLVAAHGN 160
227823993  81 ICDQALNERDYGDLSGLNKDDARAKWGEEQVHIWRRSYDVPPPGGESLRDTGARVWPYYLTEILPRVLAGEKVLVAAHGN 160
241207121  81 IRDQALNERDYGDLSGLNKDDARAKWGEEQVHIWRRSYDVPPPGGESLRDTGARVWPYYLTEILPRVLRGEKVLVAAHGN 160
209551697  81 IRDQALNERDYGDLSGLNKDDARAKWGEEQVHIWRRSYDVPPPGGESLRDTGARVWPYYLTEILPRVLRGEKVLVAAHGN 160
116249946  81 IRDQALNERDYGDLSGLNKDDARAKWGEEQVHIWRRSYDVPPPGGESLRDTGARVWPYYLTEILPRVLRGEKVLVAAHGN 160
86355829   81 IRDQALNERDYGDLSGLNKDDARARWGEEQVHIWRRSYDVPPPGGESLRDTGARVWPYYLTEILPRVLRGEKVLVAAHGN 160
190889845  81 IRDQALNERDYGDLSGLNKDDARAKWGEEQVHVWRRSYDVPPPGGESLRDTGARVWPYYLTEILPRVLHGEKVLVAAHGN 160
150398561  81 IRDQALNERDYGDLSGLNKDDARAKWGEEQVHIWRRSYDVPPPGGESLRDTGARVWPYYLTDILPRVLSGEKVLVAAHGN 160
15963915   81 IRDQALNERDYGDLSGLNKDDARAKWGEEQVHIWRRSYDVPPPGGESLRDTGARVWPYYLTDILPRVLSGEKVLVAAHGN 160
158421780 161 SLRALVMVLERLSPEGIMKRELATGAPILYRLGADATVSEKRDILI 206
222084415 161 SLRSLVMVLDRLTKEQILALNLATGVPMVYKLNADSTVASKEVLGD 206
227823993 161 SLRSLVMVLDRLTKEQVLNLNLATGVPMVYKLKADSTVASKEVLGD 206
241207121 161 SLRSLVMVLDKLSKEGVLALNLATGVPMVYTLKADSTVASKEVLGD 206
209551697 161 SLRSLVMVLDKLTKEGVLALNLATGVPMVYKLKADSTVASKEVLGD 206
116249946 161 SLRSLVMVLDKLSREGVLALNLATGVPMVYKLKADSTVASKEVLGD 206
86355829  161 SLRSLVMVLDKLTKEGVLALNLATGVPMVYKLNADSTVASKEVLGD 206
190889845 161 SLRSLVMVLDKLTKEGVLALNLATGVPMVYKLHADSTVASKEVLGD 206
150398561 161 SLRSLVMVLDGLTKEQILKLNLATGVPMVYKLNADSTVASKEVLGD 206
15963915  161 SLRSLVMVLDKLTKEQILKLNLATGVPMVYKLNADSTVASKEVLGD 206
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap