Conserved Protein Domain Family
PRK01203

?
PRK01203: PRK01203 
prefoldin subunit alpha; Provisional
Statistics
?
PSSM-Id: 100813
View PSSM: PRK01203
Aligned: 3 rows
Threshold Bit Score: 173.195
Threshold Setting Gi: 48478587
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13541362   1 MARDVEAQLNYIESLISSVDAQIDAINKMVLEVQTTIQILSSDELRQSKERLISVGSGIFANGNLDLDSDLIVPIGSGVY 80 
16082588   1 MARDVEAQLNYIESLISSVDSQIDTLNKAMIEVQSTIDLLSNGDLASSPEKLISIGSGLFAKGNITIDEDLIVPIGSGIY 80 
48478587   7 SGEELIEQANYMKSLIDSLNSRIASLSATLSEANQTLSFLKDNESDNSKQLRIMIGSGIYADATIKKDK-FIVPVGSGVF 85 
13541362  81 IAEKRSETIERLKANIENLKESIQKLMDQRRTLVDQYNTVY--TTEATRNIK 130
16082588  81 VAETKERSVERLKKNLEDIKASIQKLLDQRKTLVDQYNTVY--ATEATRNVK 130
48478587  86 IEEERERTIKRLSENLKDLNDSINRLNQQKKELENNYNMLLmqIQELDNNVR 137
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap