Conserved Protein Domain Family
PRK01172

?
PRK01172: PRK01172 
ATP-dependent DNA helicase
Statistics
?
PSSM-Id: 100801
View PSSM: PRK01172
Aligned: 3 rows
Threshold Bit Score: 1161.57
Threshold Setting Gi: 48478452
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16081891   1 MKISELGYDRAFLQLFDGNDFQLYDHQRMAIEQIRKGRNVVVSVPTAAGKTLIAYSAIYETFQRNLKSIYIVPLRSLAME 80 
13541645   1 MKISDLGYDESFLDLFEGNDFELYDHQRMAIEQFRKGKNIMVSVPTAAGKTLIAYSAIYETFKKKLKSIYIVPLRSLAME 80 
48478452   1 MKVSDV-FPDEFLNI-TGSDFELYKHQIDAIERLKNNENVIVSVPTASGKSLIGYYAIYKAFLAGKKSMYIVPLRSLAME 78 
16081891  81 KFSELSRLRDLGLKVKMSIGDYDDSPDFIKRYDAVILTSEKADSLLHHDPYILNDVGLLVLDEIHTIGDESRGPTLETVA 160
13541645  81 KYEELSRLRELGMRVKLSIGNYDDTPDFIKRYDVVILTSEKADSLMHHDPYMMEEVGLMVIDEIHMIGDEYRGPTLETVI 160
48478452  79 KYEELLNLRSLNMRITISIGDYDSPPSFIKNNDVIVVTSERADSMIHHDPDIINDFGAIIADEIHIINDEDRGPRLETVL 158
16081891 161 SIARYVNPDVRILALSATVSNAMELASWLDASLIKSDFRPVPLKTGILYRDQLYLDGKRR--SGVSINQIIRETVEDNGQ 238
13541645 161 TTARYVNPETRIIALSATVSNASEIAEWLNASLIKSSFRPVPLKVGILYRNRLFLDGDAR--SDVDINLLVKETVDDGGQ 238
48478452 159 SSIRVINPDALILGLSATISNVNELAQWLNASTVVSNFRAVPLELGIIYKKRLITDSYERylGQLDELSLIKDIINDGGQ 238
16081891 239 VLMFVSSRKKAEDTARDLAQIFGSDANIKISSDETNVYDDMLNEILPRGVAFHHAGLSNDQRAFIEREFRARRIKVIVAT 318
13541645 239 VLIFVSSRKRAEDMAKNLSQLFDPINDLKVSSEDANVYDDLLNEMLPHGVSFHHAGLSNEQRSFIEKAFRHRKLKVIVAT 318
48478452 239 ALVFRNSRKNAEKYAEMLIQHLPEFNDF-----NNDGMPESLVKMIRHGIAYHHAGLSNEDRRNIEEMFKNGYIKVISAT 313
16081891 319 PTLAAGVNLPARLVIVRDITRWGSDGISYLTNMEIKQMIGRAGRPGYDQYGIGLIYVSSQSSYEAAKDYLSTDPEPVVSY 398
13541645 319 PTLAAGVNLPARLVIVKDVTRYGDLGITYLSNMEVKQMIGRAGRPGYDQYGIGIIYAASANSYQVVKEYISEEPEPVDSY 398
48478452 314 PTLAAGVNLPARLVIIRDITRYSNGYSRPISNIEIQQMLGRAGRPKYDKMGYGYIYAASPASYDAAKKALSGEPEPVISK 393
16081891 399 LGNEAKVRFNTLAAISMGLARSPSDIMKFYETTLFFSQNGKDLLEEKISASLKFLEKNGFIKQSPDLRTTQLGKVTSDLY 478
13541645 399 IGKPEKVRFNTLAAIAMGLATSQVEMEEFYRSTFYYAQNGEDEIPNRINESIKFLKENGFIKEKDSLRATEFGKMISNLY 478
48478452 394 MDSQRLMRFNILALISSGMASRMEDLILFYNETLMAIQKDVD--DYYIESALYFLKENGFIDGDVTYNATRLGRLTSDLY 471
16081891 479 IDPESALRLVDFFDGPADVDHAIYYISLCREI--VPFNIKDDYSAMEFLDDIGLID---GDIDAAKTAIVLRDWISEASY 553
13541645 479 IDPESAIILKKYFDDNDDIDTALYYISLCREI--APINMQDDYAAMEFLESIGHID---GDIEAAKTALVLREWISEAST 553
48478452 472 IDPETALILKSALDHDYDEKLYLYYICRTPDMinIPAGTREYEYIEDFLEDINVFDfseESLSAAKTAMVLLGWINEMPM 551
16081891 554 KYLYDKYGIAPGDMQARISMADWLSYSLAKLSSIYKPEVRRMLEILNLRIKEGIREDILQLVLIPGVGRVRARRLYDAGL 633
13541645 554 RRIFEMYGVAPGDLQARVNNADWISYSLAHLASIFKPERRRKLEILNMRIKEGIREELMDLVLIPAIGRVRARRLYEAGI 633
48478452 552 QKITDTYNIGPGDVQQKASSADWISYSLYRLSSVYKKEMESKLFHLNIRIKEGIKPDLIDLIKIPKVGRVRARRLYDNGF 631
16081891 634 RSIEDVASASPDRIKAIYGFSDTLANAIIRRARTIASKEVR 674
13541645 634 HNVQELAFSDPSRIKMLYGFSDTLANAVVKRAKAIVSERIR 674
48478452 632 KTVDDIARSSPENIEKIFGFSKNLAAEIVNSAMKISSMYYR 672
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap