Conserved Protein Domain Family
PRK01156

?
PRK01156: PRK01156 
chromosome segregation protein; Provisional
Statistics
?
PSSM-Id: 100796
View PSSM: PRK01156
Aligned: 3 rows
Threshold Bit Score: 1059.51
Threshold Setting Gi: 48477311
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13541058   1 MIIERIRLRNFLSHSDSDIYFDTGINMIIGQNGAGKSSIVDAIRFALFSDKR-TRRTEDMIKKGERYMEVELYFRSEGHS 79 
16081317   1 MIIDRIRLINFLSHEDSEIFFDTGVNIIVGHNGAGKSSIIDAIRFALFGDKR-TKKIEDMIRKGAKSLEVEMEFRHGGHT 79 
48477311   1 MIIKSLKLKNFVSYDDAEIEFTPGITIITGKNGAGKTSIVDAIKFALFTETRnSEKIEEMVKKGKNNLSVMLEFYIGSDV 80 
13541058  80 YRIRRTIERRGKSISTDAEIERDGSIITRGASDVSNYVEKNVLNINKDVFLTSIFVRQGEMDALVSKDPAERKKILDEIL 159
16081317  80 YIIRRSITRRSKNPESNAMIMVDGSALSQSVKDANDYIEKNIITKSKDVFLNSVFSKQGEMDDLISGDPARRKKLLDEIL 159
48477311  81 YQVFRSY-KFGKGSRRESYIKKNNEIIAEGFDQTTKAIE-NILGISKDVFKNSIFVGQGEMDSLISGTPKQRKEIFSEIL 158
13541058 160 NIDRLEAGYLLLKEVIDDLTANVSDYDYL-------KNELQSKINEIDNNNKQIEELESKLRLIEPEIKALEEEINIKEN 232
16081317 160 EIEKLEETYDVLKDVIDSLQAGISNLDYLisenerdRDDLRRYQDDVAELSKQIDQEEAIESDLLRKKEEASAEYNAVSK 239
48477311 159 EINSLSRNADKLKDVLKMLRPEISNINDV-------EEKLKSSNLELENIKKSLADDEKSHSITLKEIERLSIVYQNAMD 231
13541058 233 KKDHLNEELHRLNAQLETIKKYEMELAESQSRKAsiemevvKLPSIEEELKRLENNAAVVKRNEIIEYINLKKDLGSLSE 312
16081317 240 ELIMLDATLKNMMSLSDEANRYEEEIRKIDGKLQ-------EISGSTERYNEITSSKVYASRERIRGYWTDKGQIIDYRK 312
48477311 232 DYNNAKSAMNELSSLEDMKNRLNSDIKTAESDLSmeleknnYYKELEERHMKIINDPVYKNRNYINDYFKYINDIENKKQ 311
13541058 313 IIEGLKSDLSKYDEAHRKLEDLQSFRSEFLEKKKRKEDLDKLRSSLKEDEDNYQSAVRNIENIKKWIENEEKEIERMSAF 392
16081317 313 MLKNIDGQVQSYEDNMKKAAELQADHDQYEIMQRRMDEIKHELDDLRTYESKYVSLINEIEQKKKKREEYRKKQKDLGDE 392
48477311 312 ILSNIDAEINKYHAIIKKLSVLEKDYNDYIKKKSEYDDLNNQILELEGYHMDYNGYLKSYESLNMKIREYSIN------- 384
13541058 393 ISEILKIQEITPEIINSRRAEINSSLMQIEGKIASLNASIDAMRSHKMEVEENAAMLSGRGVCPVCGTHLGTEKSEDLVK 472
16081317 393 ISRTLGRAFANASELVAIYEEIRRDIDEINTDLGNLQVKIGALRQKEEEIRRNMNMLEGHNKCPVCGTDLGDEGSRRIRE 472
48477311 385 ---------IDPDAIKKELNEINVKLQDYSSKVSSLNQRKRSLIENLDELSRNMEILNGQSVCPVCGTTLGEDKINHIIN 455
13541058 473 HYGEEASRLEEDINKTENEIKKLDEERKHQKKLLDRINGKDVERLIASYNLLSSKRAELKKFMDDEARLKEAHLKAEAAI 552
16081317 473 HYSEDLNRLNEEIDHLEREASAIDEKKRQLISMESYLAKGKIREYETYDRQMKDLEAQITDDENSLSTIAYKHTKYEQLD 552
48477311 456 DYNNKKSGIESKIREIEIDVKDINNKIVDLKKRKEYLESEEINKSINEYNKIESARHDLEDIKIKINELKDKEDKYNEIK 535
13541058 553 SQYNSID--LGDLEAKNEEWLKANAVISSI-DIENIRSRFEEKNKQLNDIIKRMNEI--EVNIPDVESYNENSLKRIDEE 627
16081317 553 EEYRSMH--LEDLRQKYTDWNNAMAVISNIgDIEALRKQKDEVSKKLKDAEDRTHEI--ESEFPDINSYTPSYIGKIEDE 628
48477311 536 NRIKSLKesIEILDSRRTSYLNLLSQRDLI-DIDTNQSRSNEIKSQINDLESGLQEIikIIGFEPDKSYIDK-IREMENE 613
13541058 628 LNSLRNKKNELYAKKAAMDEIQKTIEHFKEEISKKKGIEDSQAEVNAQLLQINDDLKQLSSRLDKINVDQYEWKSLHKVL 707
16081317 629 VRLLEPQIKLAEDLKRQRETLREKVKDLRSRSAGMDEIQKRKNELSVKASESETRLKYVEGQIQATLSSLSGKRSKVETL 708
48477311 614 ANNYNNKYNEIQENKILIEKLRGKIDNYKKQIAEIDSRIPDLKTITSRINDIEDNYNKSRKALDDAKANRARLEATIEIN 693
13541058 708 LQDNEKLNIAVADIRKRLEKKETIIKAIADLKRVREAFSKDGVPAIIRKSASEFITNQTRQYIQRFELDIDDVDVDQDFN 787
16081317 709 RSHVSEIEQRISDRERDIERMKKIEKAINDVKRIREAFGKNGVPAMIRQSVSDYLTAKTRDYLSSFDLDFDDISVDQDFN 788
48477311 694 RTRINELSDRINEINETLESMKKIKAAIGFLDELRNALDVSGIQSMIRKEASQAMTSLVRKYLFEFNFDFDDIDIDEDFN 773
13541058 788 ITVFRGGIAEGIDSLSGGERMAVAFALRVAIAQFLNKDVSLLVMDEPTAFLDEDRRSDLANIIEYSLKDSSGIPQVIMIS 867
16081317 789 VTVYRGGVPEGIDSLSGGEKTAVAFAIRVAVAQFLNADLSLLILDEPTAFLDEERRNSLSDIIEYTLKDSSVIPQVIIIS 868
48477311 774 IKVSQRSMVQDIDSLSGGEKTALSLALRLAVAEYALNNKSFIIMDEPTNYLDEDRRTNLKDIIQYSLRQSGDIDQLIMIT 853
13541058 868 HHRELLSASDLALEVKKRNGSSIVDVIR 895
16081317 869 HHRELLASANVAIEVKKIGGRSVVSNAD 896
48477311 854 HHSDMSSVADVSYEIDKSSGSSKIIPL- 880
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap