Conserved Protein Domain Family
PRK01066

?
PRK01066: PRK01066 
porphobilinogen deaminase; Provisional
Statistics
?
PSSM-Id: 167150
View PSSM: PRK01066
Aligned: 15 rows
Threshold Bit Score: 363.304
Threshold Setting Gi: 46445906
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
46445906    1 MLRKRSMLYSNNSQPYSISVGARSSPLSRAQVQEILKALRSFYPSIEFTISYFDTIGDLDQKTSLRDLDKTNFFTKEIDE 80 
166154510   1 -------------------MASRQSSLAVLQAHECLRKLQIFFPRLWGQIITTTTQGDLDQETPLCAVENTGFFTDDVDF 61 
166155385   1 -------------------MASRQSSLAVLQAHECLRKLQIFFPRLWGQIITTTTQGDLDQETPLCAVENTGFFTDDVDF 61 
237802722   1 -------------------MASRQSSLAVLQAHECLRKLQIFFPRLWGQIITTTTQGDLDQETPLCAVENTGFFTDDVDF 61 
237804644   1 -------------------MASRQSSLAVLQAHECLRKLQIFFPRLWGQIITTTTQGDLDQETPLCAVENTGFFTDDVDF 61 
62184962    4 DCYNNPFLSDFCLGKRPLRIASRKSILAQAQVHECVRLLRSWFPKLWIQIHTISTRGDKDKTTPIRLVENSQFFTDTVDK 83 
89898473    4 DCYTDPFLSDFCLGRRPLRIASRKSTLAKAQVYECVRLLRSWFPKLWIQIQTVNTQGDKDKTTPLRLIENSQFFTDAVDK 83 
29840104    4 DCYTDPFLSDFCSGRRPLRIASRRSTLAQAQAHECVCLLRSWFPKLWVQIHTVHTLGDKDKKTPLHLVENSQFFTDAVDK 83 
16752992    4 VCYSDPCLSDFCQGKRPLRIASRNSNLAKAQVHECISLLRSWYPKLWFQLSTTETTGDREKKIPLHLVENSYFFTDGVDA 83 
15617976    4 VCYSDPCLSDFCQGKRPLRIASRNSNLAKAQVHECISLLRSWYPKLWFQLSTTETTGDREKKIPLHLVENSYFFTDGVDA 83 
46445906   81 AILQKKCQIGIHSAKDLPDpiPDGLQLICLTKGVDCSDVLVLRDGETLQTLPPHSRIATSSIRRENIVKLLRNDFIFLDL 160
166154510  62 LVQSGQCDLGIHSAKDLPE--NPKATVVSITASIDPRDILVFHEKYLSIPLPRRLRIGSSSVRRKELLSLLYPSAIITDI 139
166155385  62 LVQSGQCDLGIHSAKDLPE--NPKATVVSITASIDPRDILVFHEKYLSIPLPRRLRIGSSSVRRKELLSLLYPSAIITDI 139
237802722  62 LVQSGQCDLGIHSAKDLPE--NPKATVVSITASIDPRDILVFHEKYLSIPLPRRLRIGSSSVRRKELLSLLYPSAIITDI 139
237804644  62 LVQSGQCDLGIHSAKDLPE--NPKATVVSITASIDPRDILVFHEKYLSIPLPRRLRIGSSSVRRKELLSLLYPSAIITDI 139
62184962   84 LVIRGNCHLAVHSAKDLPD--PPATPVVAITKGLDPSDLLVYAERYLWQRFPKVPRLGSSSSRRGETLKMLFPTGRILDI 161
89898473   84 LVLSGNSHLAVHSAKDLPN--PPVTTIIAITQGLDPADLLVYGNRYLWKRFPKNPKLGSSSLRREEILKKLFPAGKILHI 161
29840104   84 LVLRGNCHLAVHSAKDLPN--PSKTSIVAITNGLDPSDLLVYGERYLWKRFPKNPRLGSSSLRRGEMLKNLFPKGQILDI 161
16752992   84 LVHKGVCDLAIHSAKDLPE--TPSLPVVAITRCLHPADLLVYADHYVHEPLPLSPRLGSSSLRRSAVLKQLFPQGQILDI 161
15617976   84 LVHKGVCDLAIHSAKDLPE--TPSLPVVAITRCLHPADLLVYADHYVHEPLPLSPRLGSSSLRRSAVLKQLFPQGQILDI 161
46445906  161 RGTIHQRLALLEKKQADGVVVAEAALIRLGLTHLNRIRLPGTTVEGQGQLAIIARKDDAKMQTLFACLDVRKN 233
166154510 140 RGTIQTRLKLLEEKNFDAIVMANAAVSRLGLRLPCTKILPPPYHPLQGRLAITASRHIRSWRGLFLTCGITED 212
166155385 140 RGTIQTRLKLLEEKNFDAIVMANAAVSRLGLRLPCTKILPPPYHPLQGRLAITASRHIRSWRGLFLTCGITED 212
237802722 140 RGTIQTRLKLLEEKNFDAIVMANAAVSRLGLRLPCTKILPPPYHPLQGRLAITASRHIRSWRGLFLTCGITED 212
237804644 140 RGTIQTRLKLLEEKNFDAIVMANAAVSRLGLRLPCTKILPPPYHPLQGRLAITASRHIRSWRGLFLTCGITED 212
62184962  162 RGTIEERLEQLENGKYDAIVVAKAAVLRLHLQLPYTKVLPPPYHPLQGRLAITAGKDIEAWKTFLLPLNTATT 234
89898473  162 RGTIEERLEQLESGKYDAIIVAKAAALRLHLKLPYTEELPPPYHPLQGRLSVTAAKNIESWKKLLYPLNTSDI 234
29840104  162 RGTIEERLKQLESGKYDAIVVAKAAVIRLHLRLPYTKTLPPPYHPLQGRLSITAAKNIEAWKKLLLPLNASDL 234
16752992  162 RGTIEERLDQLHRGHYDAIVLAKAASLRLHLHHAYSIELPPPYHALQGSLAITAKDHAGKWKQLFTPIHCHSS 234
15617976  162 RGTIEERLDQLHRGHYDAIVLAKAASLRLHLHHAYSIELPPPYHALQGSLAITAKDHAGKWKQLFTPIHCHSS 234
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap