Conserved Protein Domain Family
lpxB

?
PRK01021: lpxB 
lipid-A-disaccharide synthase; Reviewed
Statistics
?
PSSM-Id: 167141
View PSSM: PRK01021
Aligned: 14 rows
Threshold Bit Score: 1091.76
Threshold Setting Gi: 16752067
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15605136    1 MFPQKITLWLYPLGLFANLFFGTAFCVQWSLTRKKGYSVVPKIFWYLSGTGAVFMICHGFIQSQYPIALLHSFNLIIYFR 80 
76789142    1 MFPQKITLWLYPLGLFANLFFGTAFCVQWSLTRKKGYSVVPKIFWYLSGTGAVFMICHGFIQSQYPIALLHSFNLIIYFR 80 
166155497   1 MFPQKITLWLYPLGLFANLFFGTAFCVQWFLTRKKGYSVVPKIFWYLSGTGAVFMICHGFIQSQYPIALLHSFNLIIYFR 80 
237802836   1 MFPQKITLWLYPLGLFANLFFGTAFCVQWSLTRKKGYSVVPKIFWYLSGTGAVFMICHGFIQSQYPIALLHSFNLIIYFR 80 
237804758   1 MFPQKITLWLYPLGLFANLFFGTAFCVQWSLTRKKGYSVVPKIFWYLSGTGAVFMICHGFIQSQYPIALLHSFNLIIYFR 80 
62185371    1 MFPLYLVRLLYPIGLIANLFFGFAFTLQWFLSERHKRACVPKAFWIFSSIGAILMIAHGFIQSQFPIALLHGANLVIYFR 80 
89898028    1 MLPLHLVHVLYPIGLIANLFFGSAFTIQWFLSERRKKACVPKSFWILSSIGAVMMIAHGFIQSQFPIALLHGANLVIYFR 80 
29840549    1 MLPLYLVHVLYPIGLIANLFFGSAFTIQWLLSEKRKTAYVPKAFWVLSSIGAVMMIAHGFIQSQFPMALLHGANLVIYFR 80 
16752067    1 MIPSGLVYLLYPLGFLASLFFGSAFSIQWWLSKKRKEVYAPRSFWILSSIGATLMIVHGTIQSQFPVTVLHVINLIIYLR 80 
15618872    1 MIPSGLVYLLYPLGFLASLFFGSAFSIQWWLSKKRKEVYAPRSFWILSSIGATLMIVHGTIQSQFPVTVLHVINLIIYLR 80 
15605136   81 NLNIASLNPLPVSKIASLLVSVATAITVSFAIGTRYLPHMTWMASPNILHLNLPEASLSWQLIGCIGLTIFSLRFFIQWF 160
76789142   81 NLNIASLNPLPVSKIASLLVSVATAITVSFAIGTRYLPHMTWMASPNILHLNLPEASLSWQLIGCIGLTIFSLRFFIQWF 160
166155497  81 NLNIASLNPLPVSKIASLLVSVATAITVSFAIGTRYLPHMTWMASPNILHLNLPEASLSWQLIGCIGLTIFSLRFFIQWF 160
237802836  81 NLNIASLNPLPVSKIASLLVSVATAITVSFAIGTRYLPHMTWMASPNILHLNLPEASLSWQLIGCIGLTIFSLRFFIQWF 160
237804758  81 NLNIASLNPLPVSKIASLLVSVATAITVSFAIGTRYLPHMTWMASPNILHLNLPEASLSWQLIGCIGLTIFSLRFFIQWF 160
62185371   81 NLNISSSRKLSLKTTLIILAVTLLLTALPFALEAYYHPNMQWMASPNIFHLPLPPPNMYWHMIGCLGLFTFSCRFFIQWC 160
89898028   81 NLNVSSSHSLSLRATLFILVVTLLLTTLPFVLGSYYYPNMQWMASPNIFHLPLPPPNIYWHIAGCIGLFTFSSRFFIQWC 160
29840549   81 NLNIASSYKLSLTTTLVILVLTLLVTTLPFALAAYYYPYMEWMASPNFFHLPLPPPNIYWHIVGCLGLFTFSSRFFIQWC 160
16752067   81 NLNITSSRPISFRATLVLMALSVVFVTLPF-----LYVNMEWMASPNIFHLPLPPAQLSWHLIGCLGLAIFSGRFLIQWF 155
15618872   81 NLNITSSRPISFRATLVLMALSVVFVTLPF-----LYVNMEWMASPNIFHLPLPPAQLSWHLIGCLGLAIFSGRFLIQWF 155
15605136  161 YLEYKNQSALPAPFWKASLLGGSICLLYFLRTGDLVNVLCYGCGLFPSLANLRIASREAFRKPFSN-SCFISAGEHSGDT 239
76789142  161 YLEYKNQSALPAPFWKASLLGGSICLLYFLRTGDLVNVLCYGCGLFPSLANLRIASREAFRKPFSN-SCFISAGEHSGDT 239
166155497 161 YLEYKNQSALPAPFWKASLLGGSICLLYFLRTGDLVNVLCYGCGLFPSLANLRIASREAFRKPFSN-SCFISAGEHSGDT 239
237802836 161 YLEYKNQSALPAPFWKASLLGGSICLLYFLRTGDLVNVLCYGCGLFPSLANLRIASREAFRKPFSN-SCFISAGEHSGDT 239
237804758 161 YLEYKNQSALPAPFWKASLLGGSICLLYFLRTGDLVNVLCYGCGLFPSLANLRIASREAFRKPFSN-SCFISAGEHSGDT 239
62185371  161 HLEMNNQSTLPVLFWQVGFVGGFLAFLYFIRTGDPVNILSYGCGLFPSIANLRIIYKKSRLSEFHNpSYFISAGEASGDT 240
89898028  161 HLEINNRSTLPALFWLVSFIGGFLAFLYFIRTGDPVNIISYGCGLLPSLANLLIIYKKSRLPEFHNhSYFLSAGEPSGDI 240
29840549  161 YLEMNNHSTLPALFWQAGFVGGFLAFIYFIRTGDPVNILSYGCGLLPSLANLRIIYKKSRLPKFHSpSCFLSAGEPSGDT 240
16752067  156 YIESNNTKDFPLLFWKIGLLGGLLALVYFIRIGDPINILCYGCGLFPSIANLRLFYKEQRSTPYLDtHCFLSAGEASGDI 235
15618872  156 YIESNNTKDFPLLFWKIGLLGGLLALVYFIRIGDPINILCYGCGLFPSIANLRLFYKEQRSTPYLDtHCFLSAGEASGDI 235
15605136  240 LGGNLLKEMHAKYPDIHCFGVGGPQMRAQNFHALFAMEKFQVSGFWEVLLALPKLWYRYQLLYRNILKTNPRTVICIDFP 319
76789142  240 LGGNLLKEMHAKYPDIHCFGVGGPQMRAQNFHALFAMEKFQVSGFWEVLLALPKLWYRYQLLYRNILKTNPRTVICIDFP 319
166155497 240 LGGNLLKEMHAKYPDIHCFGVGGPQMRAQNFHALFTMEKFQVSGFWEVLLALPKLWYRYQLLYRNILKTNPRTVICIDFP 319
237802836 240 LGGNLLKEMHAKYPDIHCFGVGGPQMRAQNFHALFAMEKFQVSGFWEVLLALPKLWYRYQLLYRNILKTNPRTVICIDFP 319
237804758 240 LGGNLLKEMHAKYPDIHCFGVGGPQMRAQNFHALFAMEKFQVSGFWEVLLALPKLWYRYQLLYRNILKTNPRTVICIDFP 319
62185371  241 LGSDLLRHIKALHPDKRCFGVGGPLMRQEGLEPLIHMEEFQVSGFLEILTSIFTLIKKYRKLYKAILKENPEIVFCIDFP 320
89898028  241 LGSDLLHNIKTCDPTIRCFGVGGPLMRKEGFEPLIHMEEFQVSGFLEVFFSIFGLFKKYRRLYKAILQENPETVFCIDFP 320
29840549  241 LGSDLLRNIKELNPNIHCFGVGGPLMRKEGLEPLIRMEEFQVSGFLEVFCAVFSLYKKYRKLYKAILKENPETVFCIDFP 320
16752067  236 LGGKLIQSIKSLYPNIRFWGVGGPAMRQEGLQPILNMEEFQVSGFAEVLGSLFRLYRNYRKILKTILKHKPATLIFIDFP 315
15618872  236 LGGKLIQSIKSLYPNIRFWGVGGPAMRQEGLQPILNMEEFQVSGFAEVLGSLFRLYRNYRKILKTILKHKPATLIFIDFP 315
15605136  320 DFHFLLIKKLRSRGYKGKIVHYVCPSIWAWRPSRKTVLEKYLDLLLLILPFEQNLFKDSALRTVYLGHPLSETIKSFSPN 399
76789142  320 DFHFLLIKKLRSRGYKGKIVHYVCPSIWAWRPSRKTVLEKYLDLLLLILPFEQNLFKDSALRTVYLGHPLSETIKSFSPN 399
166155497 320 DFHFLLIKKLRSRGYKGKIVHYVCPSIWAWRPSRKTVLEKYLDLLLLILPFEQNLFKDSALRTVYLGHPLSETIKSFSPN 399
237802836 320 DFHFLLIKKLRSRGYKGKIVHYVCPSIWAWRPSRKTVLEKYLDLLLLILPFEQNLFKDSALRTVYLGHPLSETIKSFSPN 399
237804758 320 DFHFLLIKKLRSRGYKGKIVHYVCPSIWAWRPSRKTVLEKYLDLLLLILPFEQNLFKDSALRTVYLGHPLSETIKSFSPN 399
62185371  321 DFHFFLIKKLRKCGYTGKIVHYVCPSIWAWRPKRKKILEKYLDTLLLILPFENELFINSPLKTIYLGHPLVKTISNFQHC 400
89898028  321 DFHFFLIKKLRKCGYKGKIIHYVCPSIWAWRPKRKKILEKYLDTLLLILPFEKDLFINSPLKTIYLGHPLVKTISNFQYC 400
29840549  321 DFHFFLIRKLRKCGYRGKIIHYVCPSIWAWRPNRKKILEKHLDTLLLILPFEKEIFKDSPLKTIYLGHPLVKTIANFQDC 400
16752067  316 DFHLLLIKKLRKHGYRGKIIHYVCPSIWAWRPKRKRILEQHLDMLLLILPFEEGLFKNTSLETVYLGHPLVEEISDYKEQ 395
15618872  316 DFHLLLIKKLRKHGYRGKIIHYVCPSIWAWRPKRKRILEQHLDMLLLILPFEEGLFKNTSLETVYLGHPLVEEISDYKEQ 395
15605136  400 LNWKDQLHLPTDKPFIAAFPGSRRSDILRNLTIQVQAFQASSLASTHHLLVSSANPEYDHLILEVLQQNRCLHSHIVPSQ 479
76789142  400 LNWKDQLHLPTDKPFIAAFPGSRRSDILRNLTIQVQAFQASSLASTHHLLVSSANPEYDHLILEVLQQNRCLHSHIVPSQ 479
166155497 400 LNWKDQLHLPTDKPFIAAFPGSRRSDILRNLTIQVQAFQASSLASTHHLLVSSANPEYDHLILEVLQQNRCLHSHIVPSQ 479
237802836 400 LNWKDQLHLPTDKPFIAAFPGSRRSDILRNLTIQVQAFQASSLASTHHLLVSSANPEYDHLILEVLQQNRCLHSHIVPSQ 479
237804758 400 LNWKDQLHLPTDKPFIAAFPGSRRSDILRNLTIQVQAFQASSLASTHHLLVSSANPEYDHLILEVLQQNRCLHSHIVPSQ 479
62185371  401 PSWKQALAI-SDQPIVALFPGSRPGDILRNLQVHIRAFLASSLAESHQLLVSSYNLKHDQTILDLLEKEGC-CGKTVPAM 478
89898028  401 SSWKQQLSI-SDQPIVALFPGSRPGDIFRNLQVQIRAFLASSLAQSHQILVSSCNPKYDKNILDVLEKEGC-RGKIISST 478
29840549  401 NAWKQQLEI-SDQPSVALFPGSRPGDIFRNLQVQARAFRSSSLAKSHQLLVSSCNPKYDKKILELLDKEGCHNNKIVPSK 479
16752067  396 ASWKEKF-LNSDRPIVAAFPGSRRGDISRNLRIQVQAFLNSSLSQTHQFVVSSSSAKYDEIIEDTLKAEGCQHSQIIPMN 474
15618872  396 ASWKEKF-LNSDRPIVAAFPGSRRGDISRNLRIQVQAFLNSSLSQTHQFVVSSSSAKYDEIIEDTLKAEGCQHSQIIPMN 474
15605136  480 FRYELMRECDFALAKCGTIVLETALNLTPTIVTCQLRPLDTFLAKYIFNIILPAYSLPNIILGRTIFPEFIGGKKDFQYE 559
76789142  480 FRYELMRECDFALAKCGTIVLETALNLTPTIVTCQLRPLDTFLAKYIFNIILPAYSLPNIILGRTIFPEFIGGKKDFQYE 559
166155497 480 FRYELMRECDFALAKCGTIVLETALNLTPTIVTCQLRPLDTFLAKYIFNIILPAYSLPNIILGRTIFPEFIGGKKDFQYE 559
237802836 480 FRYELMRECDFALAKCGTIVLETALNLTPTIVTCQLRPLDTFLAKYIFNIILPAYSLPNIILGRTIFPEFIGGKKDFQYE 559
237804758 480 FRYELMRECDFALAKCGTIVLETALNLTPTIVTCQLRPLDTFLAKYIFNIILPAYSLPNIILGRTIFPEFIGGKKDFQYE 559
62185371  479 YRYHLMRDCDCALAKCGTIALEAALNQTPTIVTCLLRPFDIFLAKYIFKIFMSAYSLPNIITKSIIFPEFIGGKSDFTPE 558
89898028  479 FRYQLMRDCDCALAKCGTIVLEAALNQTPTIVTCLLGPIDTFLAKYIFKILMPAYSLPNIITGSIIFPEFIGGKHDFNPE 558
29840549  480 FRYQLMRDCDCALAKCGTIVLEAALNQTPTIVTCLLRPFDTFLAKYIFKIFIPAYSLPNIITGSVIFPEFIGGKHDFSPE 559
16752067  475 FRYELMRSCDCALAKCGTIVLETALNQTPTIVMCRLRPFDTFLAKYIFKILLPAYSLPNIIMNSVIFPEFIGGKKDFHPE 554
15618872  475 FRYELMRSCDCALAKCGTIVLETALNQTPTIVMCRLRPFDTFLAKYIFKILLPAYSLPNIIMNSVIFPEFIGGKKDFHPE 554
15605136  560 DVAAALNILKTSQAQEKQKDSCRDVYQAINESASSMKECLSLIFETAS 607
76789142  560 DVAAALNILKTSQAQEKQKDSCRDVYQAINESASSMKECLSLIFETAS 607
166155497 560 DVAAALNILKTSQAQEKQKDSCRDVYQAINESASSMKECLSLIFETAS 607
237802836 560 DVAAALNILKTSQAQEKQKDSCRDVYQAINESASSMKECLSLIFETAS 607
237804758 560 DVAAALNILKTSQAQEKQKDSCRDVYQAINESASSMKECLSLIFETAS 607
62185371  559 EVAAAIDILANPKSREKQKRACQTLLETMETNVVTVQECLQTIHSLKS 606
89898028  559 EVAAAIDILAKPKSKEKQKLACQQLLDTLMTNVVTPEECLRIICSQNS 606
29840549  560 EVAAAIDILANPIGKEKQKYACQQLLKTMTENVITPKECLQAIYAQKN 607
16752067  555 EIATALDLLNQHGSKEKQKEDCRKLCKVMTTGQIASEEFLKRIFDTLP 602
15618872  555 EIATALDLLNQHGSKEKQKEDCRKLCKVMTTGQIASEEFLKRIFDTLP 602
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap