Conserved Protein Domain Family
PRK01008

?
PRK01008: PRK01008 
queuine tRNA-ribosyltransferase; Provisional
Statistics
?
PSSM-Id: 134464
View PSSM: PRK01008
Aligned: 15 rows
Threshold Bit Score: 678.852
Threshold Setting Gi: 46446428
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15604913    1 MALRFEILHQSKKSRARVGRIETAHGYIDTPAFVPVATNGALKGVLDHSNIPLMFCNTYHLIVHPGAEAIAAMGGLHQFI 80 
166154403   1 MALRFEILHQSKKSRARVGRIETAHGYIDTPAFVPVATNGALKGVLDHSNIPLMFCNTYHLIVHPGAEAIAAMGGLHQFI 80 
166155278   1 MALRFEILHQSKKSRARVGRIETAHGYIDTPAFVPVATNGALKGVLDHSNIPLMFCNTYHLIVHPGAEAIAAMGGLHQFI 80 
237802616   1 MALRFEILHQSKKSRARVGRIETAHGYIDTPAFVPVATNGALKGVLDHSNIPLMFCNTYHLIVHPGAEAIAAMGGLHQFI 80 
62185176    1 MALKFHVLHQSKKSRARVGRIETAHGIIDTPAFVPVATNGALKGVVDHSNIQLMFCNTYHLLVHPGTEAIAAMGGLHKFI 80 
89898226    1 MALKFHVIHQSKKSRARVGRIETDHGIIDTPAFVPVATNGALKGVVDHSNIPLMFCNTYHLLVHPGTESIAAMGGLHKFI 80 
29840339    1 MALKFHVLHQSKKSRARVGKIETAHGIIDTPAFVPVATNGALKGVIDHSNIPLMFCNTYHLLVHPGTEAIAAMGGLHKFM 80 
16752821    1 MALKFHLIHQSKKSQARVGQIETSHGVIDTPAFVPVATHGALKGVIDHSDIPLLFCNTYHLLLHPGPEAVAKLGGLHQFM 80 
15618143    1 MALKFHLIHQSKKSQARVGQIETSHGVIDTPAFVPVATHGALKGVIDHSDIPLLFCNTYHLLLHPGPEAVAKLGGLHQFM 80 
15835754    1 MALKFHLIHQSKKSQARVGQIETSHGVIDTPAFVPVATHGALKGVIDHSDIPLLFCNTYHLLLHPGPEAVAKLGGLHQFM 80 
15604913   81 GRNAPIITDSGGFQIFSLAYGSVAEEIKSCGKKKGGNTIIKVNDDGVHFKSYRDGRKLFLSPEISVQAQKDLGADIILPL 160
166154403  81 GRNAPIITDSGGFQIFSLAYGSVAEEIKSCGKKKGGNTIIKVNDDGVHFKSYRDGRKLFLSPEISVQAQKDLGADIILPL 160
166155278  81 GRNAPIITDSGGFQIFSLAYGSVAEEIKSCGKKKGGNTIIKVNDDGVHFKSYRDGRKLFLSPEISVQAQKDLGADIILPL 160
237802616  81 GRNAPIITDSGGFQIFSLAYGSVAEEIKSCGKKKGGNTIIKVNDDGVHFKSYRDGRKLFLSPEISVQAQKDLGADIILPL 160
62185176   81 HRNSPIITDSGGFQIFSLAYGSVAEEIKSCGKKKGSSSILEVTDEGVWFKSYRDGSKLFLSPEVSVQAQKDLGADIIIPL 160
89898226   81 NRDAPIITDSGGFQIFSLAYGSVAEEIKSHGKKKGSSSILEITDEGVWFKSYRDGHKLFLSPEVSVQAQKDLGADIIIPL 160
29840339   81 NRNAPIITDSGGFQIFSLAYGSVAEEIKSRGKKKGSSSILEVNDEGVWFKSYRDGHKLFLSPEVSVQAQKDLGADIIIPL 160
16752821   81 GRQAPIITDSGGFQIFSLAYGSVAEEIKSCGKKKGMSSLVKITDEGAWFKSYRDGRKLFLSPELSVQAQKDLGADIIIPL 160
15618143   81 GRQAPIITDSGGFQIFSLAYGSVAEEIKSCGKKKGMSSLVKITDEGAWFKSYRDGRKLFLSPELSVQAQKDLGADIIIPL 160
15835754   81 GRQAPIITDSGGFQIFSLAYGSVAEEIKSCGKKKGMSSLVKITDEGAWFKSYRDGRKLFLSPELSVQAQKDLGADIIIPL 160
15604913  161 DELLPFHADPTYFHQSSQRTYVWEKRSLDYHLKNPGIQSMYGVIHGGTFPDQRKLGCKFVEDLPFDGSAIGGSLGKNLQD 240
166154403 161 DELLPFHADPTYFHQSSQRTYVWEKRSLDYHLKNPGIQSMYGVIHGGTFPDQRKLGCKFVEDLPFDGSAIGGSLGKNLQD 240
166155278 161 DELLPFHADPTYFHQSSQRTYVWEKRSLDYHLKNPGIQSMYGVIHGGTFPDQRKLGCKFVEDLPFDGSAIGGSLGKNLQD 240
237802616 161 DELLPFHADPTYFHQSSQRTYVWEKRSLDYHLKNPGIQSMYGVIHGGTFPDQRKLGCKFVEDLPFDGSAIGGSLGKNLQD 240
62185176  161 DELLPFHSDTTYFLSSCARTYVWEKRSLDYHKKDPRHQSMYGVIHGGIDPKQRKIGCAFVEDHPFDGFAIGGSLGRNLNE 240
89898226  161 DELLPFHSDQQYFLSSCSRTYVWEKRSLDYHRNDPRHQSMYGVIHGGIDPEQRKIGCQFVEDHPFDGFAIGGSLGRNLNE 240
29840339  161 DELLPFHSDEKYFLSSCSRTYVWEKRSLDYHKKDPRHQSMYGVIHGGIDPEQRKIGCQFVEDHPFDGFAIGGSLGRNLQE 240
16752821  161 DELLPFHTDQEYFLTSCSRTYVWEKRSLEYHRKDPRHQSMYGVIHGGLDPEQRRIGVRFVEDEPFDGSAIGGSLGRNLQE 240
15618143  161 DELLPFHTDQEYFLTSCSRTYVWEKRSLEYHRKDPRHQSMYGVIHGGLDPEQRRIGVRFVEDEPFDGSAIGGSLGRNLQE 240
15835754  161 DELLPFHTDQEYFLTSCSRTYVWEKRSLEYHRKDPRHQSMYGVIHGGLDPEQRRIGVRFVEDEPFDGSAIGGSLGRNLQE 240
15604913  241 IVEVVGVTAANLSAERPRHLLGIGDLPSIWATVGFGIDSFDSSYPTKAARHGMILTSQGPLKINNQRYSSDLNPIEPGCS 320
166154403 241 IVEVVGVTAANLSAERPRHLLGIGDLPSIWATVGFGIDSFDSSYPTKAARHGMILTSQGPLKINNQRYSSDLNPIEPGCS 320
166155278 241 IVEVVGVTAANLSAERPRHLLGIGDLPSIWATVGFGIDSFDSSYPTKAARHGMILTSQGPLKINNQRYSSDLNPIEPGCS 320
237802616 241 IVEVVGVTAANLSAERPRHLLGIGDLPSIWATVGFGIDSFDSSYPTKAARHGMILTLQGPLKINNQRYSSDLNPIEPGCS 320
62185176  241 MVPIVDITTSYLSKDRPVHLLGIGDLPSIQATIGFGIDSFDSSYPTKAARHGLILSSQGPIKIANQAYTNDLSPIDPECT 320
89898226  241 MVPVVDITTSHLSKDRPVHLLGIGDLPSIQATVKFGIDSFDSSYPTKAARHGLILSSQGPIKIANQAYANDLSPIDPKCT 320
29840339  241 MLPVVDVTTSYLSKDRPVHLLGIGDLPSIHATVGLGIDSFDSSYPTKAARHGLILSSQGPIKIANQAYANDLSSLDPECT 320
16752821  241 MSEVVKITTSFLSKERPVHLLGIGDLPSIYAMVGFGIDSFDSSYPTKAARHGLILSKAGPIKIGQQKYSQDSSTIDPSCS 320
15618143  241 MSEVVKITTSFLSKERPVHLLGIGDLPSIYAMVGFGIDSFDSSYPTKAARHGLILSKAGPIKIGQQKYSQDSSTIDPSCS 320
15835754  241 MSEVVKITTSFLSKERPVHLLGIGDLPSIYAMVGFGIDSFDSSYPTKAARHGLILSKAGPIKIGQQKYSQDSSTIDPSCS 320
15604913  321 CLACSQGITRAYLRHLFKVHEPNAGIWASIHNMHHMQKVMREIREGILNDRI 372
166154403 321 CLACSQGITRAYLRHLFKVHEPNAGIWASIHNMHHMQKVMREIREGILNDRI 372
166155278 321 CLACSQGITRAYLRHLFKVHEPNAGIWASIHNMHHMQKVMREIREGILNDRI 372
237802616 321 CLACSQGITRAYLRHLFKVHEPNAGIWASIHNMHHMQKVMREIREGILNDRI 372
62185176  321 CLTCTSKISRAYLRHLFKVHEPNASIWASIHNLHYMQEFMKNIREQILHDRI 372
89898226  321 CLTCSSNLSRAYLRHLFKVHEPNAGIWASIHNLHHMQEVMKNIRKQILNDEI 372
29840339  321 CATCTSNISRAYLRHLFKVHEPNAAIWASIHNLHYMQEVMKNIREQILNDEI 372
16752821  321 CLTCLSGISRAYLRHLFKVREPNAAIWASIHNLHHMQQVMKEIREAILKDEI 372
15618143  321 CLTCLSGISRAYLRHLFKVREPNAAIWASIHNLHHMQQVMKEIREAILKDEI 372
15835754  321 CLTCLSGISRAYLRHLFKVREPNAAIWASIHNLHHMQQVMKEIREAILKDEI 372
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap