Conserved Protein Domain Family
PRK00647

?
PRK00647: PRK00647 
hypothetical protein; Validated
Statistics
?
PSSM-Id: 100624
View PSSM: PRK00647
Aligned: 13 rows
Threshold Bit Score: 161.573
Threshold Setting Gi: 16752546
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161723222   1 MLEGFWVLEVRVTTKARENRVVCLEDGILRVRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSI 80 
162019865   1 MLEGFWVLEVRVTTKARENRVVCLEDGILRVRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSI 80 
166154599  16 LLEGFWVLEVRVTTKARENRVVCLEDGILRVRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSI 95 
166155474  16 LLEGFWVLEVRVTTKARENRVVCLEDGILRVRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSI 95 
237802813  16 LLEGFWVLEVRVTTKARENRVVCLEDGILRVRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSI 95 
237804735  16 LLEGFWVLEVRVTTKARENRVVCLEDGILRVRVTEVPEKGKANDAVVALLANFLSIPKSDVTLIAGEASRRKKVLLPRSI 95 
15835282    1 MLEGFWVLEIRVTTKARENKVVSLEDGILRVRVTEAPERGKANDAVVALLAKFLSIPKNDVTLIAGEASRRKKVLLPRAI 80 
62184885    1 MHQEYWILEVKVTPKSKQNTIVGFEGEVLKIRVTEVPEKGKANEAVIALLAKALSLPKRDITLIPGDTSRKKRILLPKST 80 
29840014    1 MNEEYWILEVKVTPKSRENKIVGFEGEVLKIRVTEAPEKGKANEAVIALLAKTLSLPKRDVTLISGETSRKKRLLLPKST 80 
16752546    1 -MDDSWILEVKVTPKAKENKIVGFDGQALKVRVTEPPEKGKANDAVISLLAKALSLPKRDVTLIAGETSRKKKFLLPNRV 79 
15618408    1 -MDDSWILEVKVTPKAKENKIVGFDGQALKVRVTEPPEKGKANDAVISLLAKALSLPKRDVTLIAGETSRKKKFLLPNRV 79 
15836028    1 -MDDSWILEVKVTPKAKENKIVGFDGQALKVRVTEPPEKGKANDAVISLLAKALSLPKRDVTLIAGETSRKKKFLLPNRV 79 
33241848    1 -MDDSWILEVKVTPKAKENKIVGFDGQALKVRVTEPPEKGKANDAVISLLAKALSLPKRDVTLIAGETSRKKKFLLPNRV 79 
161723222  81 KAFLLEQFPSESSSTT 96 
162019865  81 KAFLLEQFPSESSSTT 96 
166154599  96 KAFLLEQFPSESSSTT 111
166155474  96 KAFLLEQFPSESSSTT 111
237802813  96 KAFLLEQFPSESSSTT 111
237804735  96 KAFLLEQFPSESSSTT 111
15835282   81 KAFLFEQFPQTSSPDA 96 
62184885   81 ESIVSHWREKGFYAGL 96 
29840014   81 ESIISHWREHGL---- 92 
16752546   80 QDIIFSLHIDV----- 90 
15618408   80 QDIIFSLHIDV----- 90 
15836028   80 QDIIFSLHIDV----- 90 
33241848   80 QDIIFSLHIDV----- 90 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap