Conserved Protein Domain Family
PRK00625

?
PRK00625: PRK00625 
shikimate kinase; Provisional
Statistics
?
PSSM-Id: 134335
View PSSM: PRK00625
Aligned: 14 rows
Threshold Bit Score: 248.903
Threshold Setting Gi: 15836569
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16751987    1 MTIILCGLPTSGKSSLGKALAKFLNLPFYDLDDLIVSNYSSalySSSAEIYKAYGDQKFSECEARILETLPPEDALISLG 80 
15605091    8 KQIFLCGLPSVGKTSFGQHLSQFLSLPFFDTDHLLSDRFHG---DSPKTIYQRYGEEGFCREEFLALTSVPVIPSIVALG 84 
76789095    8 KQIFLCGLPSVGKTSFGQHLSQFLSLPFFDTDHLLSDRFHG---DSPKTIYQRYGEEGFCREEFLALTSVPVIPSIVALG 84 
166155453   8 KQIFLCGLPSVGKTSFGQHLSQFLSLPFFDTDHLLSDRFHG---DSPKTIYQRYGEEGFCREEFLALTSVPVIPSIVALG 84 
237802792   8 KQIFLCGLPSVGKTSFGQHLSQFLSLPFFDTDHLLSDRFHG---DSPKTIYQRYGEEGFCREEFLALTSVPVIPSIVALG 84 
237804714   8 KQIFLCGLPSVGKTSFGQHLSQFLSLPFFDTDHLLSDRFHG---DSPKTIYQRYGEEGFCREEFLALTSVPVIPSIVALG 84 
62185304    1 MNIFLCGLPTVGKTLFGKALAKYLSVPFFDVDDLIVSNYGNklyPSACEIFQAIGEQEFTKLEIAALRSPCLDHSVTALG 80 
89898099    1 MNIFLCGLPTVGKTLFGKAFAKYLSISFFDIDDLIVSNYSNklySSAREVFQAVGEKEFASLEVQALLALPPNHSIIALG 80 
15618946    1 MTIILCGLPTSGKSSLGKALAKFLNLPFYDLDDLIVSNYSSalySSSAEIYKAYGDQKFSECEARILETLPPEDALISLG 80 
15836569    1 MTIILCGLPTSGKSSLGKALAKFLNLPFYDLDDLIVSNYSSalySSSAEIYKAYGDQKFSECEARILETLPPEDALISLG 80 
16751987   81 GGTLMYEASYRAI--QTRGALVFLSVELPLIYERLEKRGLPERLKeamKTKPLSEILTERIDRMKEIADYIFPVDhvDHS 158
15605091   85 GCTPIIEPSYAHIlgRNSALLVLLELPIATLCQRLQHRSIPERLA---HAPSLEDTLSQRLDKLRSLTSNAFSLR--AET 159
76789095   85 GCTPIIEPSYAHIlgRNSALLVLLELPIATLCQRLQHRSIPERLA---HAPSLEDALSQRLDKLRSLTSNAFSLR--AET 159
166155453  85 GCTPLIEPSYAHIlgRNNALLVLLELPIATLCQRLQHRSIPERLA---HAPSLEDALSQRLDKLRSLTSNAFSLR--AET 159
237802792  85 GCTPIIEPSYAHIlgRNSALLVLLELPIATLCQRLQHRSIPERLA---HAPSLEDALSQRLDKLRSLTSNAFSLR--AET 159
237804714  85 GCTPIIEPSYAHIlgRNSALLVLLELPIATLCQRLQHRSIPERLA---HAPSLEDALSQRLDKLRSLTSNAFSLR--AET 159
62185304   81 GGTIMHQEACDII--KHRGTLVYLSLPMAQIRERLLKRGLPERLK---RAPNMEEILQQRIERMQRICDYHFPLDevNLL 155
89898099   81 GGTIMHQEAFDII--KNKGTLVYLSLPITDIYKRLLQRGLPARFE---KAASVKEVLQQRINRMQCIADYHFPLNhvNLL 155
15618946   81 GGTLMYEASYRAI--QTRGALVFLSVELPLIYERLEKRGLPERLKeamKTKPLSEILTERIDRMKEIADYIFPVDhvDHS 158
15836569   81 GGTLMYEASYRAI--QTRGALVFLSVELPLIYERLEKRGLPERLKeamKTKPLSEILTERIDRMKEIADYIFPVDhvDHS 158
16751987  159 SKSSLEQASQDLITLLKS 176
15605091  160 SSEAVMRDCQSFCLRFLS 177
76789095  160 SSEAVMRDCQSFCLRFLS 177
166155453 160 SSEAVMRDCQSFCLRFLS 177
237802792 160 SSEAVMRDYQSFCLRFLS 177
237804714 160 SSEAVMRDCQSFCLRFLS 177
62185304  156 DERSLFSACESFTTLLNQ 173
89898099  156 DEHSLSSACESLNTLLNL 173
15618946  159 SKSSLEQASQDLITLLKS 176
15836569  159 SKSSLDQASQDLITLLKS 176
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap