Conserved Protein Domain Family
PRK00624

?
PRK00624: PRK00624 
glycine cleavage system protein H; Provisional
Statistics
?
PSSM-Id: 167014
View PSSM: PRK00624
Aligned: 14 rows
Threshold Bit Score: 196.974
Threshold Setting Gi: 16752606
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15605003    4 KKYYSDYHVWIEPIHSRIVKLGLSSQMREHLGNILHIDLPSLGAFIKEGEKLCILESSKSAIEVLSPVSGEVLEVNTALE 83 
76789004    4 KKYYSDYHVWIEPIHSRIVKLGLSSQMREHLGNILHIDLPSLGAFIKEGEKLCILESSKSAIEVLSPVSGEVLEVNTALE 83 
166155368   4 QKYYSDYHVWIEPIHSRIVKLGLSSQMREHLGNILHIDLPSVGSFIKEGEELCILESSKSAIEVLSPVSGEVLEVNTALE 83 
237802705   4 KKYYSDYHVWIEPIHSRIVKLGLSSQMQEHLGNILHIDLPSLGAFIKEGEKLCILESSKSAIEVLSPVSGEVLEVNTALE 83 
237804627   4 KKYYSDYHVWIEPIHSRIVKLGLSSQMREHLGNILHIDLPSLGAFIKEGEKLCILESSKSAIEVLSPVSGEVLEVNTALE 83 
62184981    1 -MWYSDYHVWIDPIHENIVRLGLTSRMRENLGQILHIDLPALGSFCKEGEVLVILESSKSAIEVLSPVSGEILEVNENLK 79 
89898455    1 -MWYSDCHVWIQPIHSDVVRLGLTDKMGKNLGKILHIDLPEVGGFCKEGEVLVILESSKSAIEVLSPVSGEIIEINESLK 79 
29840123    1 -MWDSDYHVWILPIHSDVVRLGLTARMGENLGQMLHIDLPTVGSFCKEGEVLVILESSKSAIEVLSPVSGEIIEVNEALK 79 
16752606    1 -MWYSDYHVWILPVHERVVRLGLTEKMQKNLGAILHVDLPSVGSLCKEGEVLVILESSKSAIEVLSPVSGEVIDINLDLV 79 
15618348    1 -MWYSDYHVWILPVHERVVRLGLTEKMQKNLGAILHVDLPSVGSLCKEGEVLVILESSKSAIEVLSPVSGEVIDINLDLV 79 
15605003   84 DDILPVNNATESEGWFVVLQLTEDFRSESFSLEP 117
76789004   84 DDILPVNNATESEGWFVVLQLTEDFRSESFSLEP 117
166155368  84 DDILPVNNATESEGWFVVLQLTEDFRSESFSLEP 117
237802705  84 DDILPVNNATESEGWFVVLQLTEDFRSESFSLEP 117
237804627  84 DDILPVNNATESEGWFVVLQLTEDFRSESFSLEP 117
62184981   80 EDVRLLNNSPEEAGWFVIVKLDQKLNIQNLSPKE 113
89898455   80 EDIQLLNHSPEEAGWFVIVKLDQKLNIENLSLKE 113
29840123   80 EDIQLLNNSPEESGWFMVVKLDEKLNTENLSPRK 113
16752606   80 DNPQKINEAPEGEGWLAVVRLDQDWDPSNLSLMD 113
15618348   80 DNPQKINEAPEGEGWLAVVRLDQDWDPSNLSLMD 113
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap