Conserved Protein Domain Family
PRK00611

?
PRK00611: PRK00611 
putative disulfide oxidoreductase; Provisional
Statistics
?
PSSM-Id: 100616
View PSSM: PRK00611
Aligned: 14 rows
Threshold Bit Score: 190.006
Threshold Setting Gi: 15604896
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15604896    1 MIKHLRSYCLYLAWLFSCIGTLMSVYYSYILNVEPCLLCYYQRICLFPLVVILGIAAYREDISIKIYTLPLALVGFGIAI 80 
166154386   1 MIKHLRSYCLYLAWLFSCIGTLMSVYYSYILNVEPCLLCYYQRICLFPLVVILGIAAYREDISIKIYTLPLALVGFGIAI 80 
166155261   1 MIKHLRSYCLYLAWLFSCIGTLMSVYYSYILNVEPCLLCYYQRICLFPLVVILGIAAYREDISIKIYTLPLALVGFGIAI 80 
237802600   1 MIKHLRSYCLYLAWLFSCIGTLMSVYYSYILNVEPCLLCYYQRICLFPLVVILGIAAYREDISIKIYTLPLALVGFGIAI 80 
237804522   1 MIKHLRSYCLYLAWLFSCIGTLMSVYYSYILNVEPCLLCYYQRICLFPLVVILGIAAYREDISIKIYTLPLALVGFGIAI 80 
62185179    1 MIRFLRNYALYFAWLISCTGTVMSIYYSYLLNIEPCVLCYYQRICLFPLSIILGIATYREDDLVKIYALPLSIMGMLIAV 80 
29840345    1 MIRFLRNNALYFAWLICSTGTVMSIYYSYLLNIEPCVLCYYQRICLFPLSIILGIATYREDNLVKIYALPLSITGMVIAV 80 
16752812    1 MINFIRSYALYFAWAISCAGTLISIFYSYILNVEPCILCYYQRICLFPLTVILGISAYREDSSIKLYILPQAVLGLGISI 80 
15618151    1 MINFIRSYALYFAWAISCAGTLISIFYSYILNVEPCILCYYQRICLFPLTVILGISAYREDSSIKLYILPQAVLGLGISI 80 
15835762    1 MINFIRSYALYFAWAISCAGTLISIFYSYILNVEPCILCYYQRICLFPLTVILGISAYREDSSIKLYILPQAVLGLGISI 80 
15604896   81 YQVCLQEIPGMTLDICGKVSCSTKLFLLGFITMPMASAAAFCAIACLLVLATKSK 135
166154386  81 YQVCLQEIPGMTLDICGKVSCSTKLFLLGFITMPMASAAAFCAIACLLVLATKSK 135
166155261  81 YQVCLQEIPGMTLDICGKVSCSTKLFLLGFITMPMASAAAFCAIACLLVLATKSK 135
237802600  81 YQVCLQEIPGMTLDICGKVSCSTKLFLLGFITMPMASAAAFCAIACLLVLATKSK 135
237804522  81 YQVCLQEIPGMTLDICGKVSCSTKLFLLGFITMPMASAAAFCAIACLLVLATKSK 135
62185179   81 YQICLQEIAGMTIDICGRVSCSTKLFIFGFITIPMASALAFCAISCLLILSDSKK 135
29840345   81 YQICLQEISGMTIDICGRVSCSTKLFVFGFITVPMASALAFCAISCLLILSGSKK 135
16752812   81 YQVFLQEIPGMQLDICGRVSCSTKIFLFSYVTIPMASVVAFGAIVCLLVLTKKYR 135
15618151   81 YQVFLQEIPGMQLDICGRVSCSTKIFLFSYVTIPMASVVAFGAIVCLLVLTKKYR 135
15835762   81 YQVFLQEIPGMQLDICGRVSCSTKIFLFSYVTIPMASVVAFGAIVCLLVLTKKYR 135
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap