Conserved Protein Domain Family
lspA

?
PRK00573: lspA 
signal peptidase II; Provisional
Links
?
Statistics
?
PSSM-Id: 100605
View PSSM: PRK00573
Aligned: 2 rows
Threshold Bit Score: 264.469
Threshold Setting Gi: 12045062
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13508032   1 MAKAPTFFSKLLKQILFANRKPFLYYKLALILFVGFVILFQVFMLRAALNGEkgingANGTDVARSSFISIYVIGNKGVG 80 
12045062   2 KLRKTKFFSQLKHQVLTANQKPFLFYKLTMIGFVGFIILLQVFILRNALNGE-----MDNTMVANSGFINIYVIRNKGVG 76 
13508032  81 FSLLADQPGLVYFLQGFLSFIALFFLVFSTSYNYIFWITTLAFGSLGNFFDRLTSGSGEVLDYFVFSGGNSVFNLADCCI 160
12045062  77 FSLLQNQTGLVYFLQGLLSVIALVFLVFMVKYSYIFWITTLAFGSLGNFFDRLTSANDSVLDYFIFQNGSSVFNFADCCI 156
13508032 161 TFSFIGLFLSFLIQFFKEMKQTKS 184
12045062 157 TFGFIGLFFCFLIQMFKEFKHSKN 180
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap