Conserved Protein Domain Family
PRK00568

?
PRK00568: PRK00568 
carbon storage regulator; Provisional
Statistics
?
PSSM-Id: 134322
View PSSM: PRK00568
Aligned: 11 rows
Threshold Bit Score: 107.656
Threshold Setting Gi: 34557272
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15646051   1 MLILSRKVNEGIVIDDNIHIKVISIDRGSVRLGFEAPESTLILRAELKEAIVSENQKASVCVDESLLENIKKVIKP 76 
15612400   1 MLILSRKVNEGIVIDDNIHIKVISIDRGSVRLGFEAPESTLILRTELKEAIVSENQKASASVDESLLENIKKVIKP 76 
108563793  1 MLILSRKVNEGIVIDDNIHIKVISIDRGSVRLGFEAPESTLILRAELKEAIVSENQKASACVDESVLENIKKVIKP 76 
188528212  1 MLILSRKVNEGIVIDDNIHIKVISIDRGSVRLGFEAPESTLILRAELKEAIVSENQKASASVDESLLENIKKVIKP 76 
208435310  1 MLILSRKVNEGIVIDDNIHIKVISIDRGSVRLGFEAPESTLILRAELKEAIVSENQKASASVDESVLENIKKVIKP 76 
210135609  1 MLILSRKVNEGIVIDDNIHIKVISIDRGSVRLGFEAPESTLILRAELKEAIVSENQKASASVDESLLENIKKVIKP 76 
254779953  1 MLILSRKVNEGIVIDDNIHIKVISIDRGSVRLGFEAPESTLILRAELKEAIVSENQKASVCVDESVLENIKKVIKP 76 
298735592  1 MLILSRKVNEGIVIDDNIHIKVISIDRGSVRLGFEAPESTLILRAELKEAIVSENQKASVCVDESLLENIKKVIKP 76 
109946799  1 MLILSRKVNEGIVIDDHIHIKVVSIDRGSVRLGFEAPESTLILRAELKEAIVSENQKASASVDESLLENIKKVIKP 76 
32265622   1 MLILSRKQDDSVIIGDDIEIKIISIDKGSVRLGFSAPENCVILRGELKEAITSQNKQASQSDDIKAVSEIKFLLKA 76 
34557272   1 MLILSRKEEESIVIGDEIVIKVVSIDKGSVKLGFEAPPHMLILREELKKAVADENLKASAQSDEIALTSLSQKLKK 76 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap