Conserved Protein Domain Family
PRK00560

?
PRK00560: PRK00560 
molybdenum cofactor guanylyltransferase MobA
Statistics
?
PSSM-Id: 167003
View PSSM: PRK00560
Aligned: 12 rows
Threshold Bit Score: 278.951
Threshold Setting Gi: 32266518
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15645388    1 MKNPIIDNIPCVLLAGGKSSRfitnnIQTNKALMPLKSYSSLLEYQYTRLLKLFKKVIISTK--KSYELNAPYLLE-KES 77 
15611773    1 MKNPIINNIPCVLLAGGKSSRfiinnIPINKALMPLKSYPSLLEYQYTRLLKLFKQVIISAK--KSYELNAPYLLE-KEG 77 
108563179   1 MKNPIIDNIPCVLLAGGKSSRfitnnIQANKALMPFESYSSLLEYQYTRLLKLFKKVIISTK--KSYELNAPYLLE-RES 77 
188527385   1 MKNPIIDNIPCVLLAGGKSSRfiinnIQINKALMPFESYFSLLEYQYTRLLKLFKKVIISAK--KSYELNAPYLLE-RES 77 
208434681   1 MKNPIIDNIPCVLLAGGKSSRfitnnIQTNKALMPLKSYSSLLEYQYTRLLKLFKKVIISTK--KSYELNAPYLLE-KES 77 
210134971   1 MKNPIIDNIPCVLLAGGKSSRftinnIQINKALMPLKSYSSLLEYQYTRLLKLFKQVIISAK--KSYELNAPYLLE-KES 77 
254779258   1 MKNPIIDNIPCVLLAGGKSSRftinnIQINKALMPFESYPSLLEYQYSRLLKLFKQVIISTK--KSYELNAPYLLE-KES 77 
298736473   1 MKNPIIDNIPCVLLAGGKSSRfiinnIQINKALMPLKSYSSLLEYQYSRLLKLFKKVIISTK--KSYELNAPYLLE-KES 77 
32266518    1 MQKIM---IPCVILAGGKSSR-----LGEDKTQVAFGK-ENLSQWVFTHLSKICEKVYISTKdkKKFTFDAPFLIE--RS 69 
34558294    1 MNPIQKFSTPCVILAGGKSSR-----MGKNKALLPFGGCSSLAEYQYRRLQEIFESVYISTKdsSIFEFEAEFIED--DS 73 
78778213    1 ----MLFDTPCIIFAGGKSSR-----MGEDKALLPFGSYDTLVEFQLYHLSKIFKTVYISCKekSKFNFEAAFIEDiKTL 71 
152991614   1 ----MKYKIPAVIFAGGKSSR-----MGRDKALLPFADYNSLAQYQYERLQGLFGKVYISAKk-DKFDFRTELIYD--RY 68 
15645388   78 DLFSPLFGIHNAFLTLQTPYIFFIPIDTPLVSFESIKAL--CGIKNFSVTYAKSPTKEHYLISLWHQNTLNALIYALKTQ 155
15611773   78 GLFSPLFGIHNAFLTLQTPYIFFIAIDTPLVSFESIKIL--CGIQNFSVVYAKSPTKEHYLISLWHQSILNALNYTLKTQ 155
108563179  78 DLFSPLFGIHNAFLTLQTPYIFFIPIDTPLVSFESIKAL--CGIQNFSVIYAKSPTKEHYLISLWHQNTLNALCYALKTQ 155
188527385  78 DLFSPLFGIHNAFLTLQTPYIFFIPIDTPLVSFESIKAL--CGIKNFSVIYAKSPTKEHYLISLWHQSSLNALNYALKTQ 155
208434681  78 DLFSPLFGIHNAFLTLQTPYIFFIPIDTPLVSFESIKAL--CGIKNFSVVYAKSPTKEHYLISLWHQSTLNALNYALKTQ 155
210134971  78 GLFSPLFGIHNAFLTLQTPYIFFIPIDAPLVSFESIKAL--CGIENFSVVYAKSPTKEHYLISLWHKSTLNALNYTLKTQ 155
254779258  78 DLFSPLFGIYNAFLTLQTPYIFFIAIDTPLVSFESIKTL--CGIQNFSVVYAKSPTKEHYLISLWHQNSLNALFYALKTQ 155
298736473  78 DLFSPLFGIYNAFLTLQTPYIFFIPIDTPLVSFESIKAL--CGIKNFSVIYAKSPTKEHYLISLWHQNSLNALCYALKTH 155
32266518   70 RIYAPIIGMINAFEKLKTQEILFVSVDTPFVRGETLRQL---ADSNAPITYAQSADKAHYLISKWHKSMLDALIWAYKSK 146
34558294   74 ETSAPGVAINTLFNELYAHEIFLITVDAPFVSFKTIGEIleRGKEGHEAILAKTPAKKHYLIGLYKESILPRLEELLEEK 153
78778213   72 PLYAPTAGFISVYNHLKSDNFFAISVDTPFITRSIIEKLlhVDKNTHDATIAKVNGLIQPMCGVYHRSLSEKFSQMLQNN 151
152991614  69 DVSSPLAGILSIFETLDADEIFILSVDAPFVDENVIEKLlkENKEGIDTVIAQSPDGLQPLCGIYKRSLLPLAKKHLQEN 148
15645388  156 NYRLSDLVKNTSSVAINFDKEEEFLNLNTLKDYELAVQILKKRAN 200
15611773  156 NYRLSDLIKNASSTAIHFDKEEEFLNLNTLKDYELAVQILKEGSN 200
108563179 156 NYRLSDLVKNTPSIAINFDQEEEFLNLNTLKDYELAVQILKKRAN 200
188527385 156 NYRLSDLVKNTSSIAMHLDKEEEFLNLNTLKDYELAVQILKERAN 200
208434681 156 NYRLSDLIKNASSTAIHFDKEEEFLNLNTLKDYELAVQILKEGSN 200
210134971 156 NYRLSDLVKNTSSVAIHFNQEEEFLNLNTLKDYELAVQILKKRAN 200
254779258 156 NYRLSDLVKNTSSIAIHFNQEEEFLNLNTLKDYELAVQILKEGSN 200
298736473 156 NYRLSDLVKNTSSVAIHFNQEEEFLNLNTLKDYELAVQILKKRAN 200
32266518  147 SYALHRIIESHPHQSV-LATEKECFNINTMDDYYNALKLYENME- 189
34558294  154 NYKLSALVESSETLFVDFLDEEEFSNLNTKEEYQAALAKLPSRVK 198
78778213  152 SHKLGYLLKNSNTFYVEFEDEKSFFNLNHPHEYQEALALLNS--- 193
152991614 149 RHRLTQLLKEAKSKFVAFEDDDPFTNLNHPHEYEKALKQL----- 188
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap