Conserved Protein Domain Family
PRK00466

?
PRK00466: PRK00466 
acetyl-lysine deacetylase; Validated
Statistics
?
PSSM-Id: 166979
View PSSM: PRK00466
Aligned: 12 rows
Threshold Bit Score: 515.873
Threshold Setting Gi: 77640972
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15897112    1 MLQEKELVKQKAKELLLDLLSIYTPSKSEANATKFFEKISKDLNLKLEIlPDSNSFILGEGDIL----LASHVDTVYGYI 76 
70606555    1 MFLEKDYLKLKIKQFLPEFLSIYTPSGEEYKAKDFFEKIASELDLSLQV-TSTNSYLLGDGDIL----LVGHVDTVPGFI 75 
229581465   1 MQQEKELVKQKAKELLLDLLSIYTPSKNETNATKFFEKISNEFNLKLEIlPDSNSFILGEGEIL----LASHVDTVPGYI 76 
284998488   1 --------------MLLDLLSIYTPSKNETNATKFFEKISNEFNLKLEIlPDSNSFILGEGEIL----LASHVDTVPGYI 62 
238620430   1 MQQEKELVKQKAKELLLDLLSIYTPSKNETNATKFFEKISNEFNLKLEIlPDSNSFILGEGEIL----LASHVDTVPGYI 76 
227828238   1 MQQEKELVKQKAKELLLDLLSIYTPSKNETNATKFFEKISNEFNLKLEIlPDSNSFILGEGEIL----LASHVDTVPGYI 76 
229585466   1 MQQEKELVKQKAKELLLDLLSIYTPSKNETNATKFFEKISNEFNLKLEIlPDSNSFILGEGEIL----LASHVDTVPGYI 76 
227830996   1 MQQEKELVKQKAKELLLDLLSIYTPSKNETNATKFFEKISNEFNLKLEIlPDSNSFILGEGEIL----LASHVDTVPGYI 76 
229579876   1 MQQEKELVKQKAKELLLDLLSIYTPSKNETNATKFFEKISNEFNLKLEIlPDSNSFILGEGEIL----LASHVDTVPGYI 76 
15920368    1 MQLEKELSRRKIKELLLEILSIYTPSGEEERAKDFFEKVSKEFNLNLEI-SKSKSYFLGKGDIL----LASHIDTVPGFI 75 
146302955   1 MQLEKELLKQKARKLLEQLLSVYTPSGQEGLAKGIFQKIADELNLNLYV-TSTNSFFLGDGEIL----LASHIDTVPGYI 75 
77640972    1 MVSSDAYVEGLAAKLALDLLRVYTPTGSEERLYPVLERWASELGLGFSLdSAGNAVLSAGPDGLpvvgLVGHLDTVPGRL 80 
15897112   77 EPKIENELIYGRGAVDAKGPLISMIIATWLLNEKGIKV--RVSGLADEESTSIGAKELIAKNYNFKYIIVGEPSNATDIV 154
70606555   76 NPKEEGEIIYGRGAVDDKGPLISMIIAASILNKNGYSV--TVGALSDEENKSKGAREILRIGKKYDYIIVGEPTNTFGVV 153
229581465  77 EPKIENEVIYGRGAVDAKGPLISMIIAAWLLNEKGIKV--MVSGLADEESTSIGAKELTLKNFNFKHIIVGEPSNGTDIV 154
284998488  63 EPKIENEVIYGRGAVDAKGPLISMIIAAWLLNEKGIKV--MVSGLADEESTSIGAKELTLKNFNFKHIIVGEPSNGTDIV 140
238620430  77 EPKIENEVIYGRGAVDAKGPLISMIIAAWLLNEKGIKV--MVSGLADEESTSIGAKELTLKNFNFKHIIVGEPSNGTDIV 154
227828238  77 EPKIENEVIYGRGAVDAKGPLISMIIAAWLLNEKGIKV--MVSGLADEESTSIGAKELTLKNFNFKHIIVGEPSNGTDIV 154
229585466  77 EPKIENEVIYGRGAVDAKGPLISMIIAAWLLNEKGIKV--MVSGLADEESTSIGAKELTLKNFNFKHIIVGEPSNGTDIV 154
227830996  77 EPKIENEVIYGRGAVDAKGPLISMIIAAWLLNEKGIKV--MVSGLADEESTSIGAKELTLKNFNFKHIIVGEPSNGTDIV 154
229579876  77 EPKIENEVIYGRGAVDAKGPLISMIIAAWLLNEKGIKV--MVSGLADEESTSIGAKELTLKNFNFKHIIVGEPSNGTDIV 154
15920368   76 QPKIEGEVIYGRGAVDAKGPLIAMLLATYILNEKGYKV--QFAALADEEGKSKGARELANSGIRYNYIIIGEPSNTLDVI 153
146302955  76 PPSILGEEITGRGAVDAKGPLVSMILASWIMNERGCKV--QVGALSDEENKSAGARELVSSGKRFSHIIVGEPTNTTHIA 153
77640972   81 EARLEGYTLWGRGAVDAKGPLAAMILGLHLASSEGLSCssAVLGLVGEEGDSPGAWSLVSRGDTPLHIIVGEPTGGDGVA 160
15897112  155 VEYRGSIQLDIMCEGTPEHSSSAKNNLIVDISKKIIEVYKQPENYDKPSIVPTIIRAGESYNVTPAKLYLHLDIRYAINN 234
70606555  154 VEYRGVIHLDILCRARSEHSSSATSNLIFEIAKKIINTTRINTGYDDVSIVPTIFKSGEYLNVTPSNAVVHFDIRYSVRN 233
229581465 155 VEYRGSIQLDIMCESTPEHSSSAKSNLIVDISKKIIEVYKQPENYDKPSIVPTIIRAGESYNVTPAKLYLHFDVRYAINN 234
284998488 141 VEYRGSIQLDIMCESTPEHSSSAKSNLIVDISKKIIEVYKQPENFDKPSIVPTIIRAGESYNVTPAKLYLHFDVRYAINN 220
238620430 155 VEYRGSIQLDIMCKSTPEHSSSAKSNLIVDISKKIIEVYKQPENYDKPSIVPTIIRAGESYNVTPAKLYLHFDVRYAINN 234
227828238 155 VEYRGSIQLDIMCESTPEHSSSAKSNLIVDISKKIIEVYKQPENYDKPSIVPTIIRAGESYNVTPAKLYLHFDVRYAINN 234
229585466 155 VEYRGSIQLDIMCESTPEHSSSAKSNLIVDISKKIIEVYKQPENYDKPSIVPTIIRAGESYNVTPAKLYLHFDVRYAINN 234
227830996 155 VEYRGSIQLDIMCESTPEHSSSAKSNLIVDISKKIIEVYKQPENYDKPSIVPTIIRAGESYNVTPAKLYLHFDVRYAINN 234
229579876 155 VEYRGSIQLDIMCESTPEHSSSAKSNLIVDISKKIIEVYKQPENYDKPSIVPTIIRAGESYNVTPAKLYLHFDVRYAINN 234
15920368  154 VEYRGVLHLDILCRGNSQHSSSSKENLIVDLSKKILEIYREPSNYENFSIVPTIIKSGDYINMTPSEGYLHLDIRYSIKN 233
146302955 154 VEYRGLLRINVNCHGKPEHSSSATDNIILKYIPAILESSQLPSQYSSPSIVPTIVRSGDSPNVTPSDFYVHFDVRYPYGI 233
77640972  161 IGYRGSLTIEIECTGHEGHSSNPERGAADMLVKALASILER-----DSRATVTRLKAGTAANITPGRALATVNMRFNEPG 235
15897112  235 KRE-DLIKEITDKFPE--CNLKIVDETPPVKVSINNPVVKSLARALLKQNIKPRLVKKAGTSDMNILQRIT-TNIATYGP 310
70606555  234 SKD-QIMSEIHREFEG--CEIHEVEDISPVKVDVNSDIVKVFMRSIIKENYKPTILRKRGTSDMNILKDLAlKGILAYGP 310
229581465 235 KRD-DLINEIKDKFQE--CGLKIVDETQPVKVSINNPVVKSLTRALLKQNIKPRLVRKAGTSDMNILQKIT-TSIATYGP 310
284998488 221 KRD-DLINEIKDKFQE--CGLKIVDETPPVKVSINNPVVKSLTRALLKQNIKPRLVRKAGTSDMNILQKIT-TSIATYGP 296
238620430 235 KRD-DLINEIKDKFQE--CGLKIVDETPPVKVSINNPVVKSLTRALLKQNIKPRLVRKAGTSDMNILQKIT-TSIATYGP 310
227828238 235 KRD-DLINEIKDKFQE--CGLKIVDETPPVKVSINNPVVKSLTRALLKQNIKPRLVRKAGTSDMNILQKIT-TSIATYGP 310
229585466 235 KRD-DLINEIKDKFQE--CGLKIVDETPPVKVSINNPVVKSLTRALLKQNIKPRLVRKAGTSDMNILQKIT-TSIATYGP 310
227830996 235 KRD-DLINEIKDKFQE--CGLKIVDETPPVKVSINNPVVKSLTRALLKQNIKPRLVRKAGTSDMNILQKIT-TSIATYGP 310
229579876 235 KRD-DLINEIKDKFQE--CGLKIVDETPPVKVSINNPVVKSLTRALLKQNIKPRLVRKAGTSDMNILQKIT-TSIATYGP 310
15920368  234 SKD-EILALIHNEFKT--CDIKIVEDIEPVKVDVNSNIVKAVMRGIIKQGYKPKLARKAGTSDMNILKNIA-KEIVTYGP 309
146302955 234 SEG-DILSKISEKFEG--CDLTVGESIPPVKVGPSTPAVRALMRGLLQQGVKPSLVRKGGTSDMNLLISIT-PSIATYGP 309
77640972  236 LEAlQLASELCSSLHQhrCHCSSISLLHPVKTSLSNATARALVASLRTAGVKPRIVVKRGTSDMNVLSIAT-ESIAAYGP 314
15897112  311 GNSMLEHTTQEKISLDEIYIGVKTYMLAIEELWQKI 346
70606555  311 GNSSLEHTDHEKISLDEIFIATKVYINAIEALWPKM 346
229581465 311 GNSMLEHTNQEKITLDEIYIGVKTYMLAIEELWQKS 346
284998488 297 GNSMLEHTNQEKITLDEIYIGVKTYMLAIEELWQKS 332
238620430 311 GNSMLEHTNQEKITLDEIYIGVKTYMLAIEELWQKS 346
227828238 311 GNSMLEHTNQEKITLDEIYIGVKTYMLAIEELWQKS 346
229585466 311 GNSMLEHTNQEKITFDEIYIGVKTYMLAIEELWQKS 346
227830996 311 GNSMLEHTNQEKITLDEIYIGVKTYMLAIEELWQKS 346
229579876 311 GNSMLEHTNQEKITLDEIYIGVKTYMLAIEELWQKS 346
15920368  310 GNSTLEHTNNEKISIDEIFIALTTYINAIEELCLKK 345
146302955 310 GDSRLEHTEFERITLDEIYIATLTYVNALEELCLKH 345
77640972  315 GDPRLSHTKHENIRVGDIVKAAMIYSRTLTILCNSL 350
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap