Conserved Protein Domain Family
PRK00341

?
PRK00341: PRK00341 
DUF493 domain-containing protein
Statistics
?
PSSM-Id: 166914
View PSSM: PRK00341
Aligned: 18 rows
Threshold Bit Score: 157.254
Threshold Setting Gi: 146284088
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116052036  2 TDTPDVQPPKIEFPCERYPIKVIGDAGEGFSDLVVEIIQRHApDLDVETLVVRDSSKGRFLSVQVLITATDVDQLQAIHN 81 
15599193   2 TDTPDVQPPKIEFPCERYPIKVIGDAGEGFSDLVVEIIQRHApDLDVETLVVRDSSKGRFLSVQVLITATDVDQLQAIHN 81 
152988132  2 TDTPDVQPPKIEFPCERYPIKVIGDAGEGFSDLVVEIIRRHApDLDAETLVVRDSSKGRFLSVQVLITATDVDQLQAIHN 81 
218889721  2 TDTPDVQPPKIEFPCERYPIKVIGDAGEGFSDLVVEIIQRHApDLDVETLVVRDSSKGRFLSVQVLITATDVDQLQAIHN 81 
77461186   1 MTDTEVKAPKIEFPQVDYPVKVISDTGVGNKDKIIDIVKKHA-RINDERVDERQSSNGKYTTIQLHIVATDQDQLYNINS 79 
229592797  1 MTDKEVKAPKIEFPVVDYPIKVISDTGVGRKDLILEIVRKHA-TINDQRVDERSSSTGKYTTIQLHIVATDQDQLYNINS 79 
146308808  1 MTDSDVQPPKIEFPCERYPIKVIGTAGEGFSDLVIEVIQRHApDLDASTLVMRDSRNGNFLSVQVLITATSVEQLQAIHV 80 
167035844  1 MSEPDVKSHKIEFPCDDYPIKVIGDTVVGFKDTVIEILSKHA-KVDLSTLAERQSKEGKYTTVQLHIVAESENQLHDINS 79 
148549879  1 MSEPDVKSHKIEFPCDDYPIKVIGDTVVGFKDTVIEILSKHA-KVDLSTLAERQSKEGKYTTVQLHIVAESENQLHDINS 79 
170719805  1 MSEPDVKSHKIEFPCADYPIKVIGDTVVGFKDMVIEVLSKHA-KVDLATLAERQSKEGKYTTVQLHIVAESENQLHDINS 79 
116052036 82 DLRATGRVHMVL 93 
15599193  82 DLRATGRVHMVL 93 
152988132 82 DLRATGRVHMVL 93 
218889721 82 DLRATGRVHMVL 93 
77461186  80 ELRATGFVHMVL 91 
229592797 80 ELRATGFVHMVL 91 
146308808 81 DLRATGRVHMVL 92 
167035844 80 ALRATGIVKMVL 91 
148549879 80 ALRATGIVKMVL 91 
170719805 80 ALRATGIVKMVL 91 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap