Conserved Protein Domain Family
PRK00304

?
PRK00304: PRK00304 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 166901
View PSSM: PRK00304
Aligned: 18 rows
Threshold Bit Score: 128.006
Threshold Setting Gi: 116051483
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116051483  1 MLIPHDLLEADTLNNLLEDFVTREGTDNGDETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLR 75 
15598659   1 MLIPHDLLEADTLNNLLEDFVTREGTDNGDETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLR 75 
152989399  1 MLIPHDLLEADTLNNLLEDFVTREGTDNGDETPLDVRVERARHALRRGEAVILFDPESQQCQLMLRSEVPAELLR 75 
229591742  1 MLIPYDALEVDTLTRLIEDFVTRDGTDNGDDTPLETRVLRVRQALTKGQALIVFDPDSEQCQLMLKHDVPKHLFD 75 
70731686   1 MLIPHDQLEVDTLTRLIEDFVTREGTDNGDETPLETRVLRVRQALTKGQAVIVFDPDSEQCQLMLKHDVPKELFD 75 
146307981 18 VLIPAHLLQADTLTALIEDFVTRDGTDNGDETPLETRVQRVRRALDKGEAVIVFDPDSQQCQLAMKRDVPREWLE 92 
146281816  1 MLIPHDQLESDTLTRLIEDFVTRDGTDNGDETPLDTRVARVRRALDRGEAVIVFDADSQQCQLALKRDVPREWLD 75 
71733963   1 MLIPYDQLEPDTLTRLIEDFVTREGTDNGDETPLQTRVLRVRHALTKGQAVIFFDLESQQCQLMLKHDVPKEFFE 75 
161486728  1 MLIPYDQLEPDTLTRLIEDFVTREGTDNGDETPLQTRVLRVRHALTKGQAVIFFDLESQQCQLMLKHDVPKEFFE 75 
28868836   1 MLIPYDQLEPDTLTRLIEDFVTREGTDNGDETPLQTRVLRVRHALTKGQAVIFFDLESQQCQLMLKHDVPKEFFD 75 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap