Conserved Protein Domain Family
PRK00295

?
PRK00295: PRK00295 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 166895
View PSSM: PRK00295
Aligned: 18 rows
Threshold Bit Score: 98.3068
Threshold Setting Gi: 152984516
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116048885  1 MELDARMDDLECRQAFQDDTLQALNDVVVEQQRSIERLQLQVAALIKRLEDVQGLVGEAGEDeAPPPHY 69 
15596157   1 MELDARMDDLECRQAFQDDTLQALNDVVVEQQRSIERLQLQVAALIKRLEDVQGLVGEAGEDeAPPPHY 69 
152984516  1 MELESRMDDLECRQAFQDDTLQALNEVVVEQQRSIERLQLQVAALIKRLEDVQGLVGGVEEDeAPPPHY 69 
218893069  1 MELDARMDDLECRQAFQDDTLQALNDVVVEQQRSIERLQLQVAALIKRLEDVQGLVGEAGEDeAPPPHY 69 
146306294  1 MSLEVRVTELESRLAFQEDTIQALNDELVEQHKRIERLQLQLSALARRQEELQGQVGIVEDE-APPPHY 68 
167035203  1 MTLEMRMVELETRQAFQDDTIQALNDVVVEQGRVIDRLQLQMAELIKRHEEMVGQYGSEGEE-APPPHY 68 
26987943   1 MTLEMRMVELETRQAFQDDTIQALNDVVVEQARVIERLQLQMAELIKRHEEMVGQYGSEGEE-APPPHY 68 
148546480  1 MTLEMRMVELETRQAFQDDAIQALNDVVVEQARVIERLQLQMAELIKRHEEMVGQYGSEGEE-APPPHY 68 
170723168  1 MSPESRIVELETRQAFQDDTIQELNDVVVEQGRVIQRLQLQVAELIKRYEEMVGQYGSEGEE-APPPHY 68 
146283151  3 VDLESRVTDLETRLAFQDDTIQALNDVLVEQQRLVERLQLQLVALAKRQEEMQGSLGAADEDeAPPPHY 71 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap