Conserved Protein Domain Family
hscB

?
PRK00294: hscB 
co-chaperone HscB; Provisional
Statistics
?
PSSM-Id: 166894
View PSSM: PRK00294
Aligned: 18 rows
Threshold Bit Score: 264.792
Threshold Setting Gi: 226946075
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116051836   1 MGKPCHFAQFDLQPAFLVDLDELGQRYRELVRSVHPDRFADAPEREQRLALERAAQLNEAYQTLKSAPRRALYLLTLSGH 80 
15599006    1 MGKPCHFAQFDLQPAFLVDLDELGQRYRELVRSVHPDRFADAPEREQRLALERAAQLNEAYQTLKSAPRRALYLLTLSGH 80 
152985852   1 MGKPCHFAQFDLQPTFLVDLDELGRRYRELVRSVHPDRFADAPEREQRLALERAAQLNDAYQTLKSAPRRALYLLTLNGR 80 
218889905   1 MGKPCHFAQFDLQPAFLVDLDELGQRYRELVRSVHPDRFADAPEREQRLALERAAQLNEAYQTLKSAPRRALYLLTLSGH 80 
167031903   1 MGTPCHYALFDLQPSFRLDLDKLATRYRELAREVHPDRFADASEREQRIALEKSAALNDAYQTLRSAPRRARYLLAISGH 80 
26987581    1 MGTPCHYALFDLQPSFRLDLDKLATRYRELAREVHPDRFADASEREQRIALEKSAALNDAYQTLRSAPRRARYLLAISGH 80 
148546119   1 MGTPCHYALFDLQPSFRLDLDKLATRYRELAREVHPDRFADASEREQRVALEKSAALNDAYQTLRSAPRRARYLLAISGH 80 
170723494   1 MGTPCHFALFDLQPCFRLDLDKLATRYRELAREVHPDRFADASEREQRVALEKSAALNDAYQTLRSAPRRARYLLAIGGH 80 
146283369   1 MGTPCHFALFDLKPDFELDLAQLADRYRELARQVHPDRFADAGESEQRQALERSANLNEAYQTLKSPSRRARYLLALEGH 80 
104780232   1 MGTPCHYALFDLQPAFRLDLDKLAVRYRELAREVHPDRFADASEREQRVALEKSAALNDAYQTLRSAPRRARYLLAIGGH 80 
116051836  81 ELPLEATVQDPEFLLQQMQLREELEELQDSADLAGVATFKRRLKAAQAELEREFAACWDDAQRREEAERLVRRMQFLDKL 160
15599006   81 ELPLEATVQDPEFLLQQMQLREELEELQDSADLAGVATFKRRLKAAQAELEREFAACWDDAQRREEAERLVRRMQFLDKL 160
152985852  81 ELPLEATVQDPEFLLQQMQLREELEELQDSADLAGVATFKRQLKAAQAELEGEFAACWDDARRREEAERLVRRMQFLDKL 160
218889905  81 ELPLEATVQDPEFLLQQMQLREELEELQDSADLAGVATFKRRLKAAQAELEREFAACWDDAQRREEAERLVRRMQFLDKL 160
167031903  81 EVPQEVTVHDPDFLLQQMQWREELEELQDEADLDGVGVFKKRLKFAQDTLNEDFAACWDAPGERDKAERLMRRMQFLDKL 160
26987581   81 EVPQEVTVHDPDFLLQQMQWREELEELQDEADLDGVGVFKKRLKAAQDTLNEDFAGCWDAPGERDKAERLMRRMQFLDKL 160
148546119  81 EVPQEVTVHDPDFLLQQMQWREELEELQDEADLDGVGVFKKRLKAAQDTLNEDFAGCWDAPGERDKAERLMRRMQFLDKL 160
170723494  81 EVPQEVTVHDPDFLLQQMQWREELEELQDEADLDGVAVFKKRLKAAQEQLNEDFAACWDVPAERDKAERLMRRMQFLDKL 160
146283369  81 DVPLEATVQDPAFLMQQMHWREELEELHEQADLDGVAAFKSRLKQAQQGLNDDFGQIWRDPARRVDAERLVRRMQFLDKL 160
104780232  81 EVPQEVTVHDPDFLLQQMQWREELEELQDEADLDGVGVFKKRLKVAQDTLNDDFADCWDDAAQRDKAERLMRRMQFLDKL 160
116051836 161 AQEVRQLEERLDD 173
15599006  161 AQEVRQLEERLDD 173
152985852 161 AQEVRQLEERLDD 173
218889905 161 AQEVRQLEERLDD 173
167031903 161 AQEVRQLEERLDD 173
26987581  161 AQEVRQLEERLDD 173
148546119 161 AQEVRQLEERLDD 173
170723494 161 AQEVRQLEERLDD 173
146283369 161 TQEVRQLEERLDD 173
104780232 161 AQEVRQLEERLDD 173
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap