Conserved Protein Domain Family
PRK00257

?
PRK00257: PRK00257 
4-phosphoerythronate dehydrogenase PdxB
Links
?
Statistics
?
PSSM-Id: 166874
View PSSM: PRK00257
Aligned: 26 rows
Threshold Bit Score: 536.156
Threshold Setting Gi: 34540932
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116049333   1 MRILADENIPVVDAFFADQG-SIRRLPGRAIDRAALAEVDVLLVRSVTEVSRAALAGSPVRFVGTCTIGTDHLDLDYFAE 79 
152989686   1 MRILADENIPLVDAFFADQG-SIRRLPGRAIDRAALAEVDVLLVRSVTEVSRAALAGSPVRFVGTCTIGTDHLDLDYFAE 79 
146282181   1 MHILADENIPLVDEFFAGLG-EIRRMPGRRINRAALEGVDVLLVRSVTRVDRELLQGTAVRFVGTCTIGTDHLDLDYFEQ 79 
226945055   1 MRILADENIPLVHAFFSAFG-EIRQLPGRAIVSGSLGDADVLLVRSVTRVDAALLEGSRVRFVGTCTIGTDHLDLDYLRR 79 
60679776    1 MKVIVDNKIPYIREAIEQIAdEVIYVPGKDFTPELVQDADALIIRTRTRCDRSLLAGSKVKFIATATIGFDHIDTAYCRE 80 
53711513    1 MKVIVDNKIPYIREAIEQIAdEVIYAPGKDFTPELVQDADALIIRTRTRCDRSLLAGSKVKFIATATIGFDHIDTAYCRE 80 
29348770    1 MKIIIDDKIPYIKEAAEKIAdEAIYAPGKDFTRELVQDADALIIRTRTHCNRELLEGSKVKFIATATIGFDHIDTEYCKQ 80 
150003629   1 MKIIVDNKIPYIHEAVEQIAdEVVYLPGSGFTAGDVRDADALVIRTRTRCNRELLEGSKVKFIATATIGFDHIDVDYCDE 80 
34540932    9 LKIVAEASVPYLRGIVDPVA-DITYLHSDCFSPDTIRHARVLIVRSITKCTPALLQGTDVRLITTATAGFDHIDREYCES 87 
92113472    1 MRILVDENIPLADEFFGELG-DITRLPGRDIDAAAVREQDLLVVRSITRVDAALLEGSRVRFVGTCTIGTDHVDLDYLRE 79 
116049333  80 AGIAWSSAPGCNARGVVDYVLGCLLAMAEVRGADLAERTYGVVGAGQVGGRLVEVLRGLGWKVLVCDPPRQAREPDGEFV 159
152989686  80 AGIAWSSAPGCNARGVVDYVLGCLLAMAEVRGADLAERTYGVVGAGQVGGRLVEVLRGLGWKVLVCDPPRQAREPDGEFV 159
146282181  80 SGIDWASAPGCNARGVVDYVLGCLLALAEVRGEALARRRFGVVGAGEVGGRLVEVLRGLGWDVRVCDPPRQTREA-GGFV 158
226945055  80 RGIAWASAPGCNARGVVDYVLGSLLSLAERQGVDLASRCYGVVGAGQVGGRLVEVLRGLGWRVLVCDPPRQALER-GDFV 158
60679776   81 AGITWTNAPGCNSASVAQYIQSALFILQQTRGMKLNQMTIGIVGVGNVGSKVADVARKLGIQVMLNDLPREEREESTMFA 160
53711513   81 AGITWTNAPGCNSASVAQYIQSTLFILQQTRGMKLNQMTIGIVGVGNVGSKVADVARKLGIQVMLNDLPREEREESTMFA 160
29348770   81 AGIEWANAPGCNSASVAQYIQSSLLIWKSLRNKKPDELTIGIIGVGNVGSKVAKVAQDFGMRVLLNDLPREEKEGNITFT 160
150003629  81 AGIVWKNCPGCNAGSVEQYLHSVLLLLKRRKGVRLEESCLGIVGVGHVGSRIQRMAEALGMRVLLNDPPRADRGE-TEFV 159
34540932   88 HGILWRNSPGCNATAVAQYVMCCLCRLALREGFSLKEKVMGIVGVGHVGGELKRLASAYGMEFLLCDPPRSEAEQDNSFL 167
92113472   80 AGIGFANAPGCNADSVVDYVLSSLLLLAEEDGFHLAGKTIGIVGVGNVGSRLAERLDDLDVECLLCDPPRAEAEGREDFL 159
116049333 160 SLERLLAEADVISLHTPLNRDGEHPTRHLLDEPRLAA-LRPGTWLVNASRGAVVDNQALRRLLEGGADLEVALDVWEGEP 238
152989686 160 SLERLLAEADVISLHTPLNRDGEHPTRHLLDEPRLAA-LRPGTWLVNASRGAVVDNQALRRLLEGGADLEVALDVWEGEP 238
146282181 159 TLDEVIAECDVISLHTPLSMSGDCPTFHLFDRQRLSG-LRPGAWLINASRGAVVDNAALRDLLLQRPDLEAVLDVWEGEP 237
226945055 159 DLPTLLRECDVLSVHTPLTHEGAHPTRHLFGREQLAR-LRPGTWLINASRGAVVDNRALREALAGRTDLQAVLDVWEGEP 237
60679776  161 SLKSIAEKCDIITFHVPLYKEGKYKTYHLADKHFFHS-LKKGAVIMNTSRGEVIETEALLEALRSGILSDAVIDVWEHEP 239
53711513  161 SLKSIAEKCDIITFHVPLYKEGKYKTYHLADKHFFHS-LKKGAVIMNTSRGEVIETEALLEALRSGILSDAVIDVWEHEP 239
29348770  161 SLEKIAEECDIITFHVPLYKEGKYKTYHLADGNFFRS-LQRKPVVINTSRGEVIETNALLEAINNGIISDAVIDVWEHEP 239
150003629 160 DLSVLARECDIITFHTPLNRNGKYKTFHLADADFFAG-LQRKPFIVNTSRGEVIETLALLDALKTGRIRDAVIDTWENEP 238
34540932  168 PLSRLVEQCDIISFHVPLTHEDPHATYHLIGEAFLRScADKRPILINACRGAVADTQALIRAVKSGWLQALVIDCWEGEP 247
92113472  160 SLDALLERAEIVCLHTPLVTEGEHATRHLLDASRIDA-LAPGTVLINAGRGACVDNQALRERLQRANDLRVVLDVWENEP 238
116049333 239 QADPELAAHCLIATPHIAGYSLEGKLRGTAQIYQAYCAWRGIAERVSLQDVLPETWLAGLQLNPGCDPAWALATLCRAVY 318
152989686 239 QADPELAARCLIATPHIAGYSLEGKLRGTAQIYQAYCAWRGIAERVSLQDVLPETWLAGLQLNPGCDPAWALATLCRAVY 318
146282181 238 QVDVELADLCRIATPHIAGYSLDGKLRGTAQIHAAYCAARGLEPTVELAQLMPGPALAGLTFAASAEPAEMLATLCRAVY 317
226945055 238 LVDVALAGLCHIATPHIAGYSLDGKLRGTAQVYRAFCEQQGVPPGVLLDELLPPPWLGELGLDGRADPAWALATLCRAVY 317
60679776  240 DIDLELLEKVIIGTPHIAGYSADGKANATRMSLEALCRFFRIETDYRITPPEPKNKLISTATYEEASL---------MIY 310
53711513  240 DIDLELLEKVIIGTPHIAGYSADGKANATRMSLEALCRFFRIETDYRITPPEPKNKLISTATYEEASL---------MIY 310
29348770  240 EINRELLEKVLIGTPHIAGYSADGKANATRMSLDSICRFFHLSATYEITPPAPSSPLIEAKDREEALL---------KMY 310
150003629 239 DIHPDLLQKVFLGTPHIAGYSADGKSNATRMALEELCNFFHIQADFKIV----PPALPYMDYSSDPEEAFL------QVY 308
34540932  248 DIDLSLLDLADIATPHIAGFSADGKANGARMCLEAITEVFGLEFPLLHTLAPPPPTHPIIDLSLFPDHRIERALL--HTF 325
92113472  239 GIDPALYDLVDIATPHIAGHSIDGKMRGTELVYQAAMRQFGLPARKKLGQLKPDPWLRKIVLTPWAPPLEALSLCTRACY 318
116049333 319 DPRSDDAAFRRSLTGDSATRRAAFDALRKHYPPRREITGLRVA-TGGRVELQRVVRALGAQLV 380
152989686 319 DPRSDDAAFRRSLTGDSATRRAAFDALRKHYPPRREITGLRVA-TGGQAELQRVVRALGAQLV 380
146282181 318 DPRRDDADFRRSLQGDDAQRRAAFDLLRKAYPARREIDGLAVRiEGDNPALTAVVSALGARLL 380
226945055 318 DPRRDDADFRRSLEGDEQARRSAFDALRKHYPPRREIDGLRVRlSGEAPRLRQLVRALGAEPV 380
60679776  311 DPRRDSDALKSH--------PGLFEQLRGDYPLRREEGAYRIViTK----------------- 348
53711513  311 DPRRDSDALKSH--------PGLFEQLRGDYPLRREEGAYRIViTK----------------- 348
29348770  311 NPIEDSNRLKSH--------PELFETLRGDYPLRREEKAYNIIgIK----------------- 348
150003629 309 DPTRDSDALKRH--------PEEFEHLRGNYPLRREISFLP---------------------- 341
34540932  326 DPLVPDRSLRAS--------PKTFEEQRKAYPHPREMKAFTVV--GATTEEAKILRGMDFIS- 377
92113472  319 DVRRDMLAFDRY--RRRMGMATGFDAYRAEYPLRREFSTLRVElKQNKGGLRDALEGFGFKVK 379
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap