Conserved Protein Domain Family
PRK00234

?
PRK00234: PRK00234 
Maf-like protein; Reviewed
Statistics
?
PSSM-Id: 166864
View PSSM: PRK00234
Aligned: 18 rows
Threshold Bit Score: 335.562
Threshold Setting Gi: 218890830
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146306654   1 MPALLLASSSPYRRELLDRLQLPFTWQSPSIDESRREGEAAIDLVKRLAEEKARALASSHPDHLIIGSDQVAVLdDGQIL 80 
116050974   1 MPDLILASSSPYRRELLTRLRLPFESASPDIDESHRPGESAEELVRRLSASKAEALAGRYPQHLVIGSDQVAVL-DGDIL 79 
15598168    1 MPDLILASSSPYRRELLTRLRLPFESASPDIDESHRAGESAEELVRRLSASKAEALAGRYPQHLVIGSDQVAVL-DGNIL 79 
152986189   1 MPSLILASSSPYRRELLTRLRLPFECASPDIDESHRPGESAEQLVRRLSASKAEALAGHYPQHLIIGSDQVAVL-DDNIL 79 
218890830   1 MPDLILASSSPYRRELLTRLRLPFESASPDIDESHRPEESAEELVRRLSASKAEALAGRYPQHLVIGSDQVAVL-DGNIL 79 
229592112   1 MLPLLLASSSVYRRELLSRLHLPFICSSPDIDESHRKNESAVELVKRLAEQKTRALAASHPGHLIIGSDQVAAL-EGRII 79 
70729175    1 MLPLLLASSSAYRRELLSRLRLPFTCCSPDIDESHRPGESATALVKRLAEEKARALASSHPAHLIIGSDQVAVL-GERII 79 
71737324    1 MPSLLLASSSSYRRELLTRLRLPFTCKSPDIDESHRLDETAHDLVRRLALEKARALAGEYPHHLIIGSDQVAVL-NGQIL 79 
66044887   26 MPSLLLASSSSYRRELLARLRLPFTCRSPDIDESRRPDEAAFDLVQRLAREKAEALTAEHHHHLIIGSDQVAVL-DEQVL 104
28870991    1 MPSLLLASSSPYRRELLARLRLPFACESPDIDESHRPGETPHDLVQRLAREKAEALASEYPGHLIIGSDQVAVL-DGQIL 79 
146306654  81 GKPHDLPRAQQQLRAASGSSVTFLTGLALLNTSSGRCQVDCVPFTVHFRQLSDEQILSYLQREQPFDCAGSFKSEGLGIS 160
116050974  80 GKPHTPERAIQQLRDASGNSVTFLTGLALLNSASRRIQVACVPFTVHFRHLDESRIRRYVEAERPLDCAGSFKAEGLGVS 159
15598168   80 GKPHTPERAIQQLRDASGKSVTFLTGLALLNSASRRIQVACVPFTVHFRHLDESRIRRYVEAERPLDCAGSFKAEGLGVS 159
152986189  80 GKPHTVERAVQQLLDASGRSVTFLTGLALLDSRNRHMQVDCIPFTVHFRQLDEARIRRYVEAERPLDCAGSFKAEGLGVS 159
218890830  80 GKPHTPERAIQQLRDASGKSVTFLTGLALLNSASRRIQVACVPFTVHFRHLDESRICRYVEAERPLDCAGSFKAEGLGVS 159
229592112  80 GKPHTFENAREQLLAASGKRVSFLTGLALLNSETGHCQVDCVPFTVHMRELDAERIERYLRIEQPYDCAGSFKAEGLGVS 159
70729175   80 GKPHTFEKARQQLLDASGASVTFLTGLALLNSQTGHCQVDCVPFTVNMRTLDSTRIERYLHAEQPYDCAGSFKAEGLGVS 159
71737324   80 GKPHTFERALEQLTAASGTSVTFLTGLALLNSSTGEHQVDCVPFTVHMRELDQASIERYLHAEQPYDCAGSFKAEGLGVS 159
66044887  105 GKPHSFERALEQLTAASGKSVTFLTGLALFNSSTGECQVDCVPFTVHMRELDRASIERYLHAEQPYDCAGSFKAEGLGVS 184
28870991   80 GKPHTFERAREQLTAASDTRVTFLTGLALLNSSTGECQVDCVPFTVHMRELDQASIERYLRAETPYDCAGSFKAEGLGVS 159
146306654 161 LFRSTEGADTTSLIGLPLIRLVDMLLNEGIEVP 193
116050974 160 LFRATEGEDATSLVGLPLIRLVDMLLEEGVEIP 192
15598168  160 LFRSTEGEDATSLVGLPLIRLVDMLLEEGVEIP 192
152986189 160 LFRATEGEDSSSLVGLPLIRLVDMLLAEGVEIP 192
218890830 160 LFRATEGEDATSLVGLPLIRLVDMLLEEGVEIP 192
229592112 160 LFQGTEGPDATSLVGLPLIRLVDMLLAEGVQIP 192
70729175  160 LFQSTAGSDATSLIGLPLIRLVDMLLAEGVETP 192
71737324  160 LFRSTEGSDATSLIGLPLIRLVDMLIKEGVSVP 192
66044887  185 LFRSTEGSDATSLIGLPLIRLVDMLIKEGVSVP 217
28870991  160 LFRSTQGADATSLIGLPLIRLVDMLIKEGVSVP 192
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap