Conserved Protein Domain Family
PRK00187

?
PRK00187: PRK00187 
NorM family multidrug efflux MATE transporter
Statistics
?
PSSM-Id: 166843
View PSSM: PRK00187
Aligned: 17 rows
Threshold Bit Score: 587.867
Threshold Setting Gi: 104781622
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116053442   1 MSSPSLVELKAILRLAGPLIAAQLAYVAMVFTDTVMMGKLGPDALAAGGLGAVSYAFVSTFCVGVVAAVGNLVAIRHGCD 80 
15600487    1 MSSPSLVELKAILRLAGPLIAAQLAYVAMVFTDTVMMGKLGPDALAAGGLGAVSYAFVSTFCVGVVAAVGNLVAIRHGCD 80 
152984867   1 MSPLSLVELKAILRLAGPLIAAQLAYVAMVFTDTVMMGRLGPDALAAGGLGAVSYAFVSTFCVGVVAAVGNLAAIRQGSA 80 
218894397   1 MSSPSLVELKAILRLAGPLIAAQLAYVAMVFTDTVMMGKLGPDALAAGGLGAVSYAFVSTFCVGVVAAVGNLVAIRHGCD 80 
148550372   1 MHVAPTTELKALLRLAGPLIASQLAHMLMVLTDTLMMARISPQALAGGGLGAASYSFVSIFCLGVIAAVGTLVAIRKGAN 80 
170719395   1 MHVAPTTELKALLRLAGPLVASQLAHMLMVLTDTLMMARISPQALAGGGLGAASYSFVSIFCLGVIAAVGTLVAIRKGAN 80 
71737018    1 -MQPALKELWIILRLAGPLIASQMAHMLMVFTDTVMMGKIGPEALAGGGLGAATYSFVSFFCVGVMAAVGTLVAIRHGAG 79 
66043344    1 MQHSALKELWIILRLAGPLIASQMAHMLMVFTDTVMMGKIGPEALAGGGLGAATYSFVSFFCVGVMAAVGTLVSIRHGAG 80 
28867355    1 MQPPAFKELWIILRLAGPLIASQMAHMLMVFTDTVMMGKIGPEALAGGGLGAATYSFISFFCVGVMAAVGTLVSIRHGAG 80 
104784307   1 MHVAPTTELKALLRLAGPLIASQLAHMLMVLTDTLMMARISPQALAGGGLGAASYSFVSIFCLGVIAAVGTLVAIRKGAN 80 
116053442  81 DAAGAAAAARSGLWVGAALALAAGLLLWNLRPLLLLFGQAPQTVDGAMQFLHSLTFALPGYMAFMVLRGFTSAIDRAGPV 160
15600487   81 DAAGAAAAARSGLWVGAALALAAGLLLWNLRPLLLVFGQAPQTVDGAMQFLHSLTFALPGYMAFMVLRGFTSAIDRAGPV 160
152984867  81 DPAGVAAVTRAGLWVGATLALAAGLLLWNLGPLLLAFGQAPQAVDGAMQFLRSLVFALPGYMAFMVLRGFTGAIDRAGPV 160
218894397  81 DAAGAAAAARSGLWVGAALAMAAGLLLWNLRPLLLVFGQAPQTVDGAMQFLHSLTFALPGYMAFMVLRGFTSAIDRAGPV 160
148550372  81 DIEGATRLAQNGLWLAWALALFAALVLWNLEPVLLLFGQKPENVASAAEFLTLLPLALPGYLTFMALRGFTSALGRSTPV 160
170719395  81 DIEGATRLAQNGLWLAWGLALVAALALWNLKPVLLLFGQQPENVAAATEFLTLLPLALPGYLTFMALRGFTSALGRSTPV 160
71737018   80 DTEGATRLTQAGLWLAWGMALVAALLLWNLEPILLQFGQAEANVHMAAQFLITLPFALPGLLSFMALRGFTSALGRAGPV 159
66043344   81 DTEGATRLTQAGLWLAWGMALVAALLLWNLEPILLQFGQAEANVHMAAQFLITLPFALPGLLSFMALRGFTSALGRAGPV 160
28867355   81 DSEGVTRLTQAGLWLAWGMALIAALLLWNLEPILLQLGQAEANVHMAAQFLITLPFALPGLLSFMALRGFTSALGRAGPV 160
104784307  81 DIEGATRLAQSGLWLAWGLAVLSALVLWNLKPALLLFGQKPENVDSAMQFLTLLPLALPSYMTFMALRGFTSALGRSTPV 160
116053442 161 MAISVLGALANLALNYSFIEGLFGLPRLGLAGIGLVTALVMNCMPLLLALYIRRQPAYAAYSLLRGLGRPQRAMVEEILR 240
15600487  161 MAISVLGALANLALNYSFIEGLFGLPRLGLAGIGLVTALVMNCMPLLLALYIRLQPAYAEYSLLRGLGRPQRAMVEEILR 240
152984867 161 MAISVLGALANLALNHSFIEGLFGLPRLGLGGIGLVTALVMNGMPLLLALYIRRQPAYAAYPLLRGLGRPQRATIAEILR 240
218894397 161 MAISVLGALANLALNYSFIEGLFGLPRLGLAGIGLVTALVMNCMPLLLALYIRLQPAYAEYSLLRGLGRPQRAMVEEILR 240
148550372 161 MVISLFGTVLNYLFNVALIEGMFGLPKLGLMGIGLVTAVVSMGMAAALALYIRWHSAYAAYPLRKGLSRPSLAALRELWR 240
170719395 161 MVISLVGTVLNYLFNVALIEGMFGLPKLGLMGIGLVTAVVSMGMAIALALYIRWHPAYAAYPLRKGLSRPSLPALRELWR 240
71737018  160 MTISLAGAAANFVLNYAMIHQWLGLPNLGLMGIGLVTAIVTNCMALALALHIKRHPAYAAYPISKGLSKLSRSHLKELWR 239
66043344  161 MTISLAGAAANFVLNYALIHQWLGLPNLGLMGIGLVTAIVTNCMALALALHIRLHPAYAAYPIRKGLSKLSRSHLGELWR 240
28867355  161 MTISVAGAVANFVLNYAMINQWLGLPNLGLMGIGLVTAMVTNCMALALAWHIKRHPAYAAYPISKGLSKLSRSHLKELWR 240
104784307 161 MVISLAGTVLNYLLNHALIEGMFGLPKLGLMGIGLVTALVSLGMAISLALYIRWHKAYDQYPLRKGLWRPSLPALRELWR 240
116053442 241 LGLPIGGTYAVESGMFTVATLCMGIIGDHALAAHQIAIQAVYVAFMVPVGLSYATTYRIGQHFGAGRLLEARRAGRVGIG 320
15600487  241 LGLPIGGTYAVESGMFTVATLCMGIIGDHALAAHQIAIQAVYVAFMVPVGLSYATTYRIGQHFGAGRLLEARRAGRVGIG 320
152984867 241 LGLPIGGTYAVESGMFTVATLCMGILGNHALAAHQIAIQAVYVAFMVPVGLSYATTYRIGQHFGAGRLLEARRAGRVGIG 320
218894397 241 LGLPIGGTYAVESGMFTVATLCMGIIGDHALAAHQIAIQAVYVAFMVPVGLSYATTYRIGQHFGAGRLLEARRAGRVGIG 320
148550372 241 LGLPIGGTYMVEVGLFAFAALCMGVLGSTELAAHQIALQIVSTAFMVPTGLSYAVTMRVGLYYGAGNLLAARSAGRVGIG 320
170719395 241 LGLPIGGTYMVEVGLFAFAALCMGVLGSTELAAHQIALQIVSTAFMVPTGLSYAVTMRVGLYYGAGNLLAARSAGRVGIS 320
71737018  240 LGLPIGGTYAVEVGLFTFAAFCMGAMGSTQMAAHQIALQTVSMAFMVPVGMSYAVTIRIGQHYGAGNLLMVRMAGRLGIG 319
66043344  241 LGLPIGGTYAVEVGLFTFAAFCMGAMGSTQMAAHQIALQTVSMAFMVPVGMSYAVTMRIGQHYGAGNLLMVRMAGRLGIG 320
28867355  241 LGLPIGGTYAVEVGLFTFAAFCMGAMGSTQMAAHQIALQTVSMAFMIPVGISYAVTMRIGQHYGAGNILMARTAGRLGIG 320
104784307 241 LGLPIGGTYMVEVGLFAFAALCMGVLGSTQLAAHQIALQIVSTAFMVPTGLSYAVTMRVGLYYGAGNLLAARSAGRVGIG 320
116053442 321 FGALCMLLFAGLFWWMPEAIIGLFLDRDAPANREVAAMAVSLLAIAAWFELFDGTQNVAMGAIRGLKDARTTFLVGLACY 400
15600487  321 FGALCMLLFAGLFWWMPEAIIGLFLDRDAPANREVAAMAVSLLAIAAWFELFDGTQNVAMGAIRGLKDARTTFLVGLACY 400
152984867 321 FGALCMLGFAGVFWWMPETIIGLFLDHADPVNREVTAMAVSLLAIAAWFELFDGTQNIAMGAIRGLKDARTTFLVGLACY 400
218894397 321 FGALCMLLFAGLFWWMPEAIIGLFLDRDAPANREVAAMAVSLLAIAAWFELFDGTQNVAMGAIRGLKDARTTFLVGLACY 400
148550372 321 FGAMIMFAFAALFLLLPEALVGLFIDRNDPAFAAIFQVAVQLLMVAAWFELFDGMQTIAMGSIRGLKDAKTTFLIGLVCY 400
170719395 321 FGALIMFAFAALFWLRPEMLVSLFIDGNDPAFAAIYQLAVSLLMVAAWFELFDGVQTIAMGSIRGLKDAKTTFLIGLCCY 400
71737018  320 FGGCVMLMFGLLFWLAPNVVIGLFLDINDPAFAEIVVLAAKLLAIAALFEFFDGTQTIAMGAIRGLKDARTTFLIGLGCY 399
66043344  321 FGGCVMLMFGLLFWLAPHLVIGLFLDINDPAFAEIVVLATKLLAIAALFEFFDGTQTIAMGAIRGLKDARTTFLIGLGCY 400
28867355  321 FGGSVMLLFGIFFWLAPHWVIGLFLDLDDPAFAEIVVLAAKLLAIAAWFEFFDGTQTIAMGAIRGLKDARTTFLIGLGCY 400
104784307 321 FGASLMLGFAVLFLVLPNELVALLVNRHDPAFAPIFQLAVQLVMVAAWFELFDGVQTIAMGSIRGLKDARTTFLIGAVCY 400
116053442 401 WLVGVPLACLLAFAAGWGAAGVWWGLAGGLACAAIGLTLAFEWKTARLLPKATASETSALNCRA 464
15600487  401 WLVGVPLACLLAFAAGWGAAGVWWGLAGGLACAAIGLTLAFEWKTARLLPKATASEASALNCRA 464
152984867 401 WLVGVPLACLLAFTAGWGPQGVWWGLAGGLACAAIGLTLAFEWKTARLLPGTSAQEATALNC-- 462
218894397 401 WLVGVPLACLLAFAAGWGAAGVWWGLAGGLACAAIGLTLAFEWKTARLLPKATASEASALNCRA 464
148550372 401 WLVGAPSAWLFTFTLGGGAVGIWWGLALGLACAAVALTFGFEWRMKRLLGKAWAAGKATASA-- 462
170719395 401 WLVGAPSAWLLTFNLGGGAVGVWWGLALGLACASVALTLAFEWRMKRMLGKAGVTAKAVIPA-- 462
71737018  400 WLIAAPAAWLLGFSTDAGASGVWWGLALGLFCSAVALTYAFEWKTARLLRREAAGLAVPA---- 459
66043344  401 WLIAAPAAWLLGFSTDAGASGVWWGLALGLFCSAVALTYAFEWKTARLLRQDAAGLPVPG---- 460
28867355  401 WLIAAPAAWLLGFYADGGASGVWWGLALGLFCSAVALTYAFEWKTARLLRKEAVGAAVPG---- 460
104784307 401 WLVGAPCAWLFAFTLGGGAPGIWWGLALGLACASVALTFGFEWRMKRMIGKAGITAKAAVPAHL 464
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap