Conserved Protein Domain Family
PRK00183

?
PRK00183: PRK00183 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 166842
View PSSM: PRK00183
Aligned: 18 rows
Threshold Bit Score: 294.4
Threshold Setting Gi: 226944053
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116048967   1 MTQPTCPCGSGDPLDDCCGRYHQGHPAPTAEALMRSRYSAYALGLVDYLRDTTLPAQQAGLDLDGIRAWSHGSTWLGLEV 80 
15596236    1 MTQPSCPCGSGDPLDDCCGRYHQGHPAPTAEALMRSRYSAYALGLVDYLRDTTLPAQQAGLDLDGIRAWSHGSTWLGLEV 80 
152985244   4 MNQPSCPCGSGDPLDECCGRYHRGHPAPTAEALMRSRYSAYALGLVDYLRETTLPAQQAGLDLDGIRAWSHGSTWLGLDV 83 
218892999   1 MTQPSCPCGSGDPLDDCCGRYHQGHPAPTAEALMRSRYSAYALGLVDYLRDTTLPAQQAGLDLDGIRAWSHGSTWLGLEV 80 
229588850   1 MSTSICPCGSGNLLDACCGHYHAGHPAPCATALMRSRYSAYVLGLVDYLVATTLPAQQAGLDRHAIGAWSAQSTWLGLEV 80 
70728653    9 MSASICPCGSGNLLDACCGHYHAGHPAPCAEALMRSRYSAYVLGQVDYLLATTLPAQQAGLDRQSISDWSAQSTWLGLQV 88 
146306452   3 QLDPSCPCGSGKLLGQCCGPYHAGSHAPSAELLMRSRYSAYVLGLVDYLVATTLPVQQSALDRDAMAAWSAQATWLGLEV 82 
71734197    1 MSSAICPCGSGDLLLACCGRYHAGQPAPCAEKLMRSRYSAYVLGLTDYLVQTTLPVQQSGLNREAIAQWSAQSTWLGLEV 80 
66047090    1 MSSAICPCGSGDLLLACCGRYHAGQPAPGAEKLMRSRYSAYVLGLTDYLVQTTLPVQQGGLDREAIAQWSAQSTWLGLEV 80 
28871269    1 MSSAICPCGSGDLLLACCGHYHAGQPAPCAEKLMRSRYSAYVLGLTDYLVQTTLPVQQAALDREAIAQWSAQSTWLGLEV 80 
116048967  81 ENHEVLGGQPEHARVTFVARWHDAEGEHAHRECSGFVQRNGRWYFLDPTVALKLGRNDPCPCGAGGKLKKCCGPWIT 157
15596236   81 ENHEVLGGQPEHARVTFVARWHDADGEHAHRECSGFVQRNGRWYFLDPTVALKLGRNDPCPCGAGGKLKKCCGPWIT 157
152985244  84 ESHEVLGGKPEHARVTFTARWHDAAGEHAHRECSGFVQRDGRWYFLDPTVALGLGRNDPCPCGAGGKLKKCCGPWIN 160
218892999  81 ENHEVLGGQPEHARVTFVARWHDADGEHAHRECSGFVQRNGRWYFLDPTVALKLGRNDPCPCGAGGKLKKCCGPWIT 157
229588850  81 ESSEVFGGQPEHAFVTFTARWHDSTGEHSHREQSSFVQNDGRWYFIDPTVEVKVGRNDACLCGSGQKFKKCCSSYL- 156
70728653   89 ESSEVFGGQPEHAFVTFTARWHDSQGEHSHRERSSFVQNQGRWYFIDPTVPLKSGRNDACPCGSGHKFKKCCASYFS 165
146306452  83 EGSEVFGGQPEHAQVTFTARWHDENGEHCHRECSAFVQVQGRWYFLDPTAPLKAGRNDPCPCQGGQKFKKCCAPYLG 159
71734197   81 ESSEVFGGKPEHAFVTFTARWHDGNGEHSHKERSSFVQNQGRWYFIDSTVPLKAGRNDACPCGSEQKFKKCCSPYVV 157
66047090   81 ESSEVFGGKPEHAFVTFTARWHDGNGEHSHRERSSFVQNQGRWYFIDSTVPLKAGRNDACPCGSEQKFKKCCSAYVE 157
28871269   81 ESAEVLGGKPEHAFVTFTARWHDGNGEHSHKERSSFVQNQGHWYFIDSTVPLKAGRNDGCPCGSEQKFKKCCSAYVI 157
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap