Conserved Protein Domain Family
tolB

?
PRK00178: tolB 
Tol-Pal system protein TolB
Statistics
?
PSSM-Id: 166839
View PSSM: PRK00178
Aligned: 24 rows
Threshold Bit Score: 741.147
Threshold Setting Gi: 120554619
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116048897   1 MSTLIRIALFALALVAGAAQAADP-LVISSGNDRAIPIAVVPFGFQGGNVLPEDMSNIIGNDLRNSGYFEPLPRQNMISQ 79 
15596169    1 MSTLIRIALFALALMAGAAQAADP-LVISSGNDRAIPIAVVPFGFQGGNVLPEDMSNIIGNDLRNSGYFEPLPRQNMISQ 79 
152989051   1 MSTLIRIALFALALVAGAAQAADP-LVISSGNDRAIPIAVVPFGFQGGNVLPEDMSNIIGNDLRNSGYFEPLPRQNMISQ 79 
218893057   1 MSTLIRIALFALALVAGAAQAADP-LVISSGNDRAIPIAVVPFGFQGGNVLPEDMSNIIGNDLRNSGYFEPLPRQNMISQ 79 
146283138   1 -------------------------------------------------MLPEDMAEIIGNDMRNTGIFQPIPRQNMISM 31 
226945713   1 MNTLIRLALFGLALLAGIAQAADP-LVVTSGTARATPIAVVPFGWQGGSVMSDDMAEIVGNDLRNSGVFEPIPRQNMISQ 79 
254787335   1 --MIYRMVLIPLLLLLSLSTRAELmIEITQGMDNPTPIAIVPFS--GSGDLPENIQQIVSSDLLRSGFFRPLAPSDMLSL 76 
120554619  13 FLKTPVIACLVLFLTASLGARAELlIRITEGAGSAIPIAVVPFAESGSMPAGDKVGSIVQADLTMSGEFRPLEPSKMLSL 92 
152996216   1 MMFKKCLSVLFTCLIFISSARAQLvIEITSGADQLLPIAVVPFGYEGVDALPEDIAQIVEADLARSGLFQPIPRSNMLSM 80 
92113976    1 MKRLNLWAASLLLMLCAGMAHAELtIEITKGSDQAIPIAIVPMA--NGDDLPENVSRIVSNDLERSGRFEPLPRESLISR 78 
116048897  80 PAQASEVIFRDWKAVGVNYVMVGNIVPAGGR----LQVQYALFDVGTEQQVLTG-SVTGSTDQLRDMSHYIADQSFEKLT 154
15596169   80 PAQASEVIFRDWKAVGVNYVMVGNIVPAGGR----LQVQYALFDVGTEQQVLTG-SVTGSTDQLRDMSHYIADQSFEKLT 154
152989051  80 PAQASEVIFRDWKAVGVNYVMVGNIVPAGGR----LQVQYALFDVGTEQQVLTG-SVTGSTDQLRDMSHYIADQSFEKLT 154
218893057  80 PAQASEVIFRDWKAVGVNYVMVGNIVPAGGR----LQVQYALFDVGTEQQVLTG-SVTGSTDQLRDMSHYIADQSFEKLT 154
146283138  32 PTRGSEIIYRDWKALGAQYVMVGNIEPAGGR----LQARYEVFNVTTEQQVMSG-TVGGSPDQLRDMAHHAADQSFEKLT 106
226945713  80 PTGPGEIIYRDWNALGAQYVLVGNIVPAGGR----LQVQYALMNVATEQQVLAG-SVSGSGDQVRDMAHYIADQAFEKLT 154
254787335  77 PSRQQDIFYRDWRILGVEYLVIGQVREAAVGaaddYIVDFQLYDVLGQRNVMQK-TITGSVAELRDIAHEISDVLYQTLT 155
120554619  93 PSERSEVYFRDWRMLGQRYVLVGQLTRNGDR----IQARYELFDVNQEKRILGE-TAAVPASNLRSLGHHISDRVYEAIT 167
152996216  81 PSKEADVFYRDWRLLKSDYVVIGAIKKLPNNq---YRIGFELLNVLSQKPVQKHsSIDVSARNFRDAAHYISDKVYELLT 157
92113976   79 PSSSEEVHYQDWQQLDSDYLVVGKIDNQGGE----YRIQYELLNVNGQNRMLGE-VVTSSRDQLRDSAHYISDQIFEEIT 153
116048897 155 GIKGAFSTKMLYVTAERFSVDnTRYTLQRSDYDGARPVTLLQSREPIVSPRFSPDGRRIAYVSFEQKRPRIFIQYVDTGR 234
15596169  155 GIKGAFSTKMLYVTAERFSVDnTRYTLQRSDYDGARPVTLLQSREPIVSPRFSPDGRRIAYVSFEQKRPRIFIQYVDTGR 234
152989051 155 GIKGAFSTKMLYVTAERFSVDnTRYTLQRSDYDGARPVTLLQSREPIVSPRFSPDGRRIAYVSFEQKRPRIFIQYVDTGR 234
218893057 155 GIKGAFSTKMLYVTAERFSVDnTRYTLQRSDYDGARPVTLLQSREPIVSPRFSPDGRRIAYVSFEQKRPRIFIQYVDTGR 234
146283138 107 GIKGAFSTRLLYVTAERMGGAnTRYTLQRSDYDGARAVTLLQSREPILSPRYSPDGRRIAYVSFEQKRPRIFVQHIDTGR 186
226945713 155 GIKGAFSTRLLYVTAERMGGG-TRYTLQRADYDGARAVILLQSREPILSPRFAPDGRRIAYVSFEQKRPRIFIQHIDTGR 233
254787335 156 GIRGAFSTKILYIEDLRREGA-GRYRLVKADADGAREKVLFTTSEPLLSPTWSNDMTQVAYVSFETGRPAIFRQNLLTGV 234
120554619 168 GAPGVFSTKLAYITVSGEGEQ-TRYRLQVSDVDGKRSKVRLESREPILSPAWSPDGKKLAYVSFETGKPVIFVHELATGE 246
152996216 158 GTRGAFSTRILYVTAEGDKKA-PLFKLQVADADGHRPQVVVESKEPILSPSWSMDGRKIAYVMFRNRRPNIFIQELATGK 236
92113976  154 GIRGAFSTSIAYVTASGVGDD-IDYALSVADADGHNSQQILSSDEPILSPAWSPDGGKLAYVSFETGRPGIYVQNLATGQ 232
116048897 235 REQITNFEGLNGAPAFSPDGNRLAFVLSRDGNPEIYVMDLGSRALRRLTNNLAIDTEPFWGKDGSTLYFTSDRGGKPQIY 314
15596169  235 REQITNFEGLNGAPAFSPDGNRLAFVLSRDGNPEIYVMDLGSRALRRLTNNLAIDTEPFWGKDGSTLYFTSDRGGKPQIY 314
152989051 235 REQITNFEGLNGAPAFSPDGNRLAFVLSRDGNPEIYVMDLGSRSLRRLTNNLAIDTEPFWGKDGSTLYFTSDRGGKPQIY 314
218893057 235 REQITNFEGLNGAPAFSPDGNRLAFVLSRDGNPEIYVMDLGSRALRRLTNNLAIDTEPFWGKDGSTLYFTSDRGGKPQIY 314
146283138 187 REQITNFEGLNGAPAFSPDGNRLAFVLSKDGNPEIYVMDLGSRQLQRLTNHYAIDTEPFWGADGQTIYYTSDRAGKPQVY 266
226945713 234 REQITNFEGLNGAPAFSPDGSRLAFVLSKDGNPEIYVMNLASRQLQRVTNHFGIDTEPFWGADGQTLYFTSDRAGKPQIY 313
254787335 235 REQLTNFKGLNGAPAWSPDDSKLAMVLSKDGNPELYTLDIASKKLTRVTNHFAIDTEPNWTADGKGLIFTSNRGGNPQIY 314
120554619 247 RQKVADFPGLNSAPAWSADGRSLLMTLSRDGNAEIYRMDLASRNLTRLTDHWAIDTEAAWDHADRGIYFTSDRSGGPQLY 326
152996216 237 RQQIAQFRGLNGAPAWSPDGKKLALVLSKDNNPEIYTLDIATQKLERMTNHYAIDTEPSWEPDGKGIVFTSDRGGNPQIY 316
92113976  233 RVRLTSFEGINGAPAWSPDGRKLAMSLSKDGQPEIYVMDIASRDLRRLTQSDAIDTEPEWAPNGRSLIFTSDRSGNPQIY 312
116048897 315 KMNVNSGAVDRVTFIGNYNANPKLSADEKTLVMVHRQQGytNFQIAAQDLQRGNLRVLSNTTLDDSPTVAPNGTMLIYAT 394
15596169  315 KMNVNSGAVDRVTFIGNYNANPKLSADEKTLVMVHRQQGytNFQIAAQDLQRGNLRVLSNTTLDDSPTVAPNGTMLIYAT 394
152989051 315 KMNVSSGAVDRVTFIGNYNANPKLSADEKTLVMVHRQQGytNFQIAAQDLQRGNLRVLSNTTLDDSPTVAPNGTMLIYAT 394
218893057 315 KMNVNSGAVDRVTFIGNYNANPKLSADEKTLVMVHRQQGytNFQIAAQDLQRGNLRVLSNTTLDDSPTVAPNGTMLIYAT 394
146283138 267 KQRLGSNSAERVTFVGNYNANPKLSADEKTLVMIHRQDGytNFKVAAQDLQRGNLRILSDTSLDESPTVAPNGTMLIYAT 346
226945713 314 RQTI-GGGAERVSFVGNYNANPKLSADEKTLVMIHRQDGytNFKVAAQDLQRGTLRVLSDTSLDESPTVAPNGTMLIYAT 392
254787335 315 QVGLETGRVERLTFEGDYNARPRVTPDGKSLVMVHRYKG--VFHIAWQDIASGDMRILTETWLDESPSIAPNGAMLLYAT 392
120554619 327 HMERPGAEPRRITFGSRYNARPRPSPTGDYVYYVHQRDS--AFHIARTNLETGEETVITRTGSDESPSVAPNGRLLIYAT 404
152996216 317 RLDVNSKRVERVTFEGDLNTRARMTPDGRYLVTVQKNDG--NYHIALQDMKTGRVQILTETYLDESPSIAPNGSMVMYAT 394
92113976  313 RYDLGSGRAERLTFTGSYNSRGRFSPDGDAIFMVTRDDS--GYHVARQDLDTDRMTILTDSDWDESPSVAPNGTMVIFAT 390
116048897 395 RQQDRGVLMLVSINGRVRIPLPTAQGDVREPSWSPYLN 432
15596169  395 RQQDRGVLMLVSINGRVRIPLPTAQGDVREPSWSPYLN 432
152989051 395 RQQDRGVLMLVSINGRVRIPLPTAQGDVREPSWSPYLN 432
218893057 395 RQQDRGVLMLVSINGRVRIPLPTAQGDVREPSWSPYLN 432
146283138 347 RQQGRGVLMLVSINGRVRLPLPTAQGEVREPSWSPYLN 384
226945713 393 RHQGRGVLMLASINGRVRLPLPTAQGEVREPSWSPYLK 430
254787335 393 KYNDKGVLAAVSMDAGVKFRLPSKQGDVREPAWSPFVK 430
120554619 405 RQNGEGVLTVVSADGGAAYSLPASEGEVREPAWGPVTR 442
152996216 395 TYQGKGILAVVSVDGLVKYRLPSADGDVREPSWSPYFK 432
92113976  391 QEGTRGVLGAVSADGSASFRLPSPQGDVREPAWSPFLD 428
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap