Conserved Protein Domain Family
rnpA

?
PRK00038: rnpA 
ribonuclease P protein component
Links
?
Statistics
?
PSSM-Id: 134052
Aligned: 5 rows
Threshold Bit Score: -1
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33603965    1 MPRATLPAEARLHRPSEFAAALKGRRLARGAFFIVSASPCAPADDQPARARLGLVIAKRFAARAVTRNTLKRVIREAFRA 80 
33598886    1 MPRATLPAEARLHRPSEFAAALKGRRLARGAFFIVSASPCAPADDQPARARLGLVIAKRFAARAVTRNTLKRVIREAFRA 80 
33591702    1 MPRATLPAEARLHRPSEFAAALKGRRLARGAFFIVSASPCAPADDQPARARLGLVIAKRFAARAVTRNTLKRVIREAFRA 80 
187479883   1 MSCATLPAEARLHRPSEFTAALKGRRLARGALFIVSAAPATSA---PACARLGLVIAKRYAALATTRNAIKRVLREAFRH 77 
163859334   1 MPRATLPPEARLHRPSEFAAALKGRRLARGAFFILSAAPSSPPPGQAAQARLGMVIAKRYAAHASTRNALKRVIREAFRH 80 
33598886    1 MPRATLPAEARLHRPSEFAAALKGRRLARGAFFIVSASPCAPADDQPARARLGLVIAKRFAARAVTRNTLKRVIREAFRA 80 
33591702    1 MPRATLPAEARLHRPSEFAAALKGRRLARGAFFIVSASPCAPADDQPARARLGLVIAKRFAARAVTRNTLKRVIREAFRA 80 
187479883   1 MSCATLPAEARLHRPSEFTAALKGRRLARGALFIVSAAPATSA---PACARLGLVIAKRYAALATTRNAIKRVLREAFRH 77 
163859334   1 MPRATLPPEARLHRPSEFAAALKGRRLARGAFFILSAAPSSPPPGQAAQARLGMVIAKRYAAHASTRNALKRVIREAFRH 80 
33603965   81 RRLALPAQDYVVRLHSKLTPASLTALKRSARAEVDAHFTRIAR 123
33598886   81 RRLALPAQDYVVRLHSKLTPASLTALKRSARAEVDAHFTRIAR 123
33591702   81 RRLALPAQDYVVRLHSKLTPASLTALKRSARAEVDAHFTRIAR 123
187479883  78 RRQALPAQDYVIRLHSKVGPLSLTALKRAARTEADAHFGRIAR 120
163859334  81 CRLELPPQDYVLRLHSKPAPATLTSLKRLARAEVDAHFARVRP 123
33598886   81 RRLALPAQDYVVRLHSKLTPASLTALKRSARAEVDAHFTRIAR 123
33591702   81 RRLALPAQDYVVRLHSKLTPASLTALKRSARAEVDAHFTRIAR 123
187479883  78 RRQALPAQDYVIRLHSKVGPLSLTALKRAARTEADAHFGRIAR 120
163859334  81 CRLELPPQDYVLRLHSKPAPATLTSLKRLARAEVDAHFARVRP 123
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap