Conserved Protein Domain Family
PRK00036

?
PRK00036: PRK00036 
primosomal replication protein N; Reviewed
Links
?
Statistics
?
PSSM-Id: 134050
View PSSM: PRK00036
Aligned: 5 rows
Threshold Bit Score: 173.682
Threshold Setting Gi: 33600900
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33600900    1 MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGHPRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPAR 80 
33597055    1 MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGHPRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPAR 80 
33593751    1 MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGHPRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPAR 80 
187478664   1 MNQLHLSVRVLECEPLRHTPAGVAALEMLLGHGSEVIEAGHPRRVELTITAVALGDLAQMLAGVALGTEMQVEGFLAPAR 80 
163857368   1 MNTLELSARVLECEPLRHTPAGVPALEMLLAHESEIVEAGHPRRVELTITAVALGDLAQLLAGTPLGTELQVQGFLAAAR 80 
33600900   81 KDSVKVKLHLQQARRIAGSMGRDPLVG 107
33597055   81 KDSVKVKLHLQQARRIAGSMGRDPLVG 107
33593751   81 KDSVKVKLHLQQARRIAGSMGRDPLVG 107
187478664  81 KDSVKLKLHLQRARKTGGSTGSDPVLA 107
163857368  81 KDSVKVKLHMQLARRVGGSAGRDPLVG 107
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap