Conserved Protein Domain Family
truB

?
PRK00020: truB 
tRNA pseudouridine synthase B; Provisional
Statistics
?
PSSM-Id: 134035
View PSSM: PRK00020
Aligned: 5 rows
Threshold Bit Score: 484.139
Threshold Setting Gi: 163857443
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33602220    1 MAKRRGLALDGVLLLDKPVGLSSNHALQRAKRTVDAAKAGHTGTLDPFATGLLVCCMGRATKISGRMLEADKTYQATLQF 80 
33592377    1 MAKRRGLALDGVLLLDKPVGLSSNHALQRAKRTVDAAKAGHTGTLDPFATGLLVCCMGRATKISGRMLEADKTYQATLQF 80 
163857443   1 MAKRRGLALDGVLLLDKPVGLSSNHALQRARRSMDAAKAGHTGTLDPFATGLLVCCMGRATKISGAMLDADKAYRATLQF 80 
187478882   1 MAKRRGQPLDGVLLLDKPVGLSSNHALQRAKRTLDAAKAGHTGTLDPFATGLLLCCMGRATKISGAMLNADKTYRATLQF 80 
33596485    1 MAKRRGLALDGVLLLDKPVGLSSNHALQRAKRTVDAAKAGHTGTLDPFATGLLVCCMGRATKISGRMLEADKTYQAMLQF 80 
33602220   81 GEETDSGDLTGHIVARAPDGFAGVEEAALRDVLSRFVGTIEQIPPMYSALKRDGKPLYEYARAGIELDRPPRQVTIRHIE 160
33592377   81 GEETDSGDLTGHIVARAPDGFAGVEEAALRDVLSRFVGTIEQIPPMYSALKRDGKPLYEYARAGIELDRPPRQVTIRHIE 160
163857443  81 GEETDSGDLTGHVVARAAEGYS-VTEDALREVLARFQGVIEQVPPMYSALKRDGKPLYEYARQGIELERPPRQVTIHRID 159
187478882  81 GEETDSGDLTGNIVARAPEDFPGVEEANLREVLSRFQGSIEQIPPMYSALKRDGKPLYEYARAGIELERPPRRVMIYRIE 160
33596485   81 GEETDSGDLTGHIVARAPDGFAGVEEAALRDVLSRFVGTIEQIPPMYSALKRDGKPLYEYARAGIELDRPPRQVTIRHIE 160
33602220  161 LLSFSGMQAQIDVACSKGTYIRTLAQDIGRALGCHAHLAALRRTHVGPFSLDRAVTLEALQAMPDAKQALLAMNELPAGL 240
33592377  161 LLSFSGMQAQIDVACSKGTYIRTLAQDIGRALGCHAHLAALRRTHVGPFSLDRAVTLEALQAMPDAKQALLAMNELPAGL 240
163857443 160 LLSLSGTRAEIDVACSKGTYIRTLAQDIGRALGCYAHLAALRRTHVGPFSLDRAVTLEALQAMTDPKQALLALNELPAGL 239
187478882 161 LLSFTGHQAEIDVACSKGTYIRTLAQDIGRALGCYAHLFALRRTQVGPFSLDRAVTLDALQAMTDPKAALLALNELPAGL 240
33596485  161 LLSFSGMQAQIDVACSKGTYIRTLAQDIGRALGCHAHLAALRRTHVGPFSLDRAVTLEALQAMPDAKQALLAMNELPAGL 240
33602220  241 LPAT 244
33592377  241 LPAT 244
163857443 240 LPAK 243
187478882 241 LPAT 244
33596485  241 LPAT 244
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap