Conserved Protein Domain Family
ribB

?
PRK00014: ribB 
3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional
Statistics
?
PSSM-Id: 134031
View PSSM: PRK00014
Aligned: 5 rows
Threshold Bit Score: 392.081
Threshold Setting Gi: 163854328
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33603945    1 MSNV---VPTPVSPLFAQPFATRLERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPG 77 
33598868    1 MSNV---VPTPVSPLFAQPFATRLERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPG 77 
187479860   1 MSN------QNLSPLFAQPFPMRLERALHHLRLGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCVCLPG 74 
33591684    1 MSNV---VPTPVFPLFAQPFATRLERALQHLRIGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDGSGIVCLCLPG 77 
163854328   1 MSSVissVPYLPPDLTAQPFEARLARALHHMRLGRPVILMDDFDRENEADLIVAADKLTVPVMAQLIRDCSGIVCLCLTD 80 
33603945   78 ETLDRLELPPMVDSNRSRYSTAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGARSGDVVSPGHVFPLRAQPGGVLTRRG 157
33598868   78 ETLDRLELPPMVDSNRSRYSTAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGARSGDVVSPGHVFPLRAQPGGVLTRRG 157
187479860  75 DILDTLQLAPMVPRNQSRYATAFTVSIEAASGVSTGVSAVDRVTTIRAAIAPNAKAGDVVSPGHVFPLRAQEGGVLTRRG 154
33591684   78 ETLDRLELPPMVDSNRSRYSTAFTVSIEAREGVTTGVSAVDRVTTIRAAIAPGARSGDVVSPGHVFPLRAQPGGVLTRRG 157
163854328  81 DTLEQLQLPPMVARNESRYSTAFTVSIEARHGVSTGVSAADRVTTIRAAIAPGAQAADIVSPGHVFPLRAQPGGVLARRG 160
33603945  158 HTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKEGLVALAIDELAAHLQARGATGAPAELAVAA 230
33598868  158 HTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKEGLVALAIDELAAHLQARGATGAPAELAVAA 230
187479860 155 HTEGSVDLARLAGLRPAGVLCELMNADGTMMRGTALEHYAAVQGLVALTIAELAEHLRAETAGAVEADEAALA 227
33591684  158 HTEGSVDLAALAGLRPAGVLCELMNADGTMMRGASLERYAAKEGLVALAIDELAAHLQARGATGAPAELAVAA 230
163854328 161 HTEGSVDLAVLAGLRPAAVLCELMNADGTMARGPSIARYAAEHGLVALTIAELAMH-RQRLAAQAPAQPALAE 232
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap