Conserved Protein Domain Family
PLN03059

?
PLN03059: PLN03059 
beta-galactosidase; Provisional
Statistics
?
PSSM-Id: 166698
View PSSM: PLN03059
Aligned: 3 rows
Threshold Bit Score: 1825.39
Threshold Setting Gi: 225444920
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255546097   1 MLKGSNTVFLFLFllfllssSWVCSILATVSYDHRAITINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYV 80 
225444920   4 MLRGSLVVFILIF-------SWVSHGSASVTYDKRSFIINGQRKILISGSIHYPRSTPEMWPDLIQKAKDGGLDVIQTYV 76 
224087947   4 VF-----LLLLLLqllfffsSRISTVTASVSYDHKAVIINGQRRILISGSIHYPRSTPEMWPDLIQKAKDGGVDVIQTYV 78 
255546097  81 FWNGHEPSPGNYYFEDRYDLVKFIKVVQAAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIEFRTDNGPFKAAMQKFTEK 160
225444920  77 FWNGHEPSRGKYYFEGRYDLVRFIKVVQAAGLYVHLRIGPYICAEWNFGGFPVWLKYVPGIAFRTDNGPFKVAMQGFTQK 156
224087947  79 FWNGHEPSPGNYYFEDRYDLVKFIKLVQQAGLYLHLRIGPYICAEWNFGGFPVWLKYVPGIEFRTDNGPFKAAMQKFTEK 158
255546097 161 IVSMMKSEKLFESQGGPIILSQIENEFGPVEWEIGAPGKAYTKWAADMAVKLGTGVPWVMCKQDDAPDPVINTCNGFYCE 240
225444920 157 IVDMMKSEKLFQPQGGPIIMSQIENEYGPVEYEIGAPGKAYTKWAAEMAVQLGTGVPWVMCKQEDAPDPVIDACNGFYCE 236
224087947 159 IVGMMKSEKLFENQGGPIILSQIENEYGPVEWEIGAPGKAYTKWAADMAVKLGTGVPWIMCKQEDAPDPMIDTCNGFYCE 238
255546097 241 NFKPNKDYKPKLWTENWTGWYTEFGGAVPYRPAEDLAFSVARFIQNGGSFMNYYMYHGGTNFGRTSAGLFIATSYDYDAP 320
225444920 237 NFFPNKDYKPKMFTEAWTGWYTEFGGAIPNRPAEDLAYSVARFIQNRGSFINYYMYHGGTNFGRTAGGPFISTSYDYDAP 316
224087947 239 NFKPNKDYKPKIWTEAWTGWYTEFGGAVPHRPAEDMAFSVARFIQNGGSYINYYMYHGGTNFGRTAGGPFIATSYDYDAP 318
255546097 321 LDEYGLTRDPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGSNQEAHVFQSKS-SCAAFLANYDTKYSVKVTFGNGQYDLP 399
225444920 317 IDEYGLPSEPKWGHLRDLHKAIKLCEPALVSADPTVTYLGTNLEAHVYKAKSgACAAFLANYDPKSSAKVTFGNTQYDLP 396
224087947 319 LDEFGLPREPKWGHLRDLHKAIKLCEPALVSVDPTVTSLGSNQEAHVFKSKS-VCAAFLANYDTKYSVKVTFGNGQYELP 397
255546097 400 PWSISILPDCKTAVFNTARLGAQSSQMKMTPVgGALSWQSYIEEAATGYTDDTTTLEGLWEQINVTRDASDYLWYMTNVN 479
225444920 397 PWSVSILPDCKNVVFNTARIGAQSSQMKMNPV-STFSWQSYNEETASAYTEDTTTMDGLLEQINITRDTTDYLWYMTEVH 475
224087947 398 PWSVSILPDCKTAVYNTARLGSQSSQMKMVPAsSSFSWQSYNEETASADDDDTTTMNGLWEQINVTRDATDYLWYLTDVK 477
255546097 480 IDSDEGFLKNGDSPVLTIFSAGHSLHVFINGQLAGTVYGSLENPKLTFSQNVKLTAGINKISLLSVAVGLPNVGVHFEKW 559
225444920 476 IKPDEGFLKTGQYPVLTVMSAGHALHVFINGQLSGTVYGELSNPKVTFSDNVKLTVGTNKISLLSVAMGLPNVGLHFETW 555
224087947 478 IDADEGFLKSGQNPLLTIFSAGHALHVFINGQLAGTAYGGLSNPKLTFSQNIKLTEGINKISLLSVAVGLPNVGLHFETW 557
255546097 560 NAGILGPVTLKGLNEGTRDLSGWKWSYKIGLKGEALSLHTVTGSSSVEWVEGSLSAKKQPLTWYKATFDAPEGNDPVALD 639
225444920 556 NAGVLGPVTLKGLNEGTVDMSSWKWSYKIGLKGEALNLQAITGSSSDEWVEGSLLAQKQPLTWYKTTFNAPGGNDPLALD 635
224087947 558 NAGVLGPITLKGLNEGTRDLSGQKWSYKIGLKGESLSLHTASGSESVEWVEGSLLAQKQALTWYKTAFDAPQGNDPLALD 637
255546097 640 MSSMGKGQIWVNGQSIGRHWPAYTARGSCSACNYAGTYDDKKCRSNCGEPSQRWYHVPRSWLNPSGNLLVVFEEWGGEPS 719
225444920 636 MSSMGKGQIWINGESIGRHWPAYTAHGNCNGCNYAGIFNDKKCQTGCGGPSQRWYHVPRSWLKPSGNQLIVFEELGGNPA 715
224087947 638 MSSMGKGQMWINGQNIGRHWPGYIAHGSCGDCNYAGTFDDKKCRTNCGEPSQRWYHVPRSWLKPSGNLLAVFEEWGGDPT 717
255546097 720 GISLVKRTTGSVCADIFEGQPALKNWQMIALGRLDHLQPKAHLWCPHGQKISKIKFASYGSPQGTCGSFKAGSCHAHKSY 799
225444920 716 GITLVKRTMDRVCADIFEGQPSLKNSQIIGSSKVNSLQSKAHLWCAPGLKISKIQFASFGVPQGTCGSFREGSCHAHKSY 795
224087947 718 GISFVKRTTASVCADIFEGQPALKNWQAIASGKVISPQPKAHLWCPTGQKISQIKFASFGMPQGTCGSFREGSCHAHKSY 797
255546097 800 DAFEKKCIGKQSCSVTVAAEVFGGDPCPDSSKKLSVEAVCT 840
225444920 796 DALQRNCIGKQSCSVSVAPEVFGGDPCPGSMKKLSVEALCS 836
224087947 798 DAFERNCVGKQSCSVTVAPEVFGGDPCPDSAKKLSVEAVCS 838
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap