Conserved Protein Domain Family
PLN03058

?
PLN03058: PLN03058 
dynein light chain type 1 family protein; Provisional
Statistics
?
PSSM-Id: 166697
View PSSM: PLN03058
Aligned: 5 rows
Threshold Bit Score: 266.476
Threshold Setting Gi: 225424335
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15220678    1 MEGVELELERRSKFLNSLIQKKKAKEQQDQKDEFNVRVRASDMPLPQQNRAFSLSREILNATPGKADNKRLAHALKKDFD 80 
224099533   1 MEGAELELERRSKFLSGLIEKRKAKEHQEQPSKLSVRVRAADMPIVLQDRAFRCARDQLDSMPGKLDSKRLALALKKEFD 80 
224111466   1 MDGAELELERRSKFLSSLIEKKKAKEHQEQHSKLNVRVRAADMPVLLQDRAFRCARDQLDSMPGKLDSKRLALALKKEFD 80 
225424335   3 MGGAEEELERRSKFLSSLIQKKKATEQHDH---LNVRVRASDMPLALQSRAFKCARDNLDAMPGKLDSKRLALALKKEFD 79 
297845392   1 MEGVELELERRSKFLNSLIQKKKAKEQQDQKDEFNVRVRASDMPLVQQNRAFSLSREILNATPGKADNKRLALTLKKDFD 80 
15220678   81 SAYGPAWHCIVGTSFGSYVTHSTGGFLYFQIDKVYVLLFKTAVEPLDQ 128
224099533  81 AAYGPAWHCIVGTSFGSYVTHSTGGFLYFSIDKVYILLFRTAVEPLER 128
224111466  81 AAYGPAWHCIVGTSFGSYVTHSTGGFLYFSIDKVYILLFRTAVEPLNR 128
225424335  80 SLYGPAWHCIVGTSFGSYVTHSLGGFLYFSIDKVYILLFKTAVEPLDH 127
297845392  81 SAYGPAWHCIVGTSFGSYVTHSIGGFIYFQIDKVYVLLFKTAVEPLDQ 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap