Conserved Protein Domain Family
PLN03039

?
PLN03039: PLN03039 
ethanolaminephosphotransferase; Provisional
Statistics
?
PSSM-Id: 166679
View PSSM: PLN03039
Aligned: 2 rows
Threshold Bit Score: 623.943
Threshold Setting Gi: 42571453
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42571453  10 MGFMFLVTSSLLGYIYSPQLDSPPPRWVHFAHGLLLFLYQTFDAVDGKQARRTNSSSPLGELFDHGCDALACAFEAMAFG 89 
79313441   1 MGFMFLLTSALLGYIYSPKLDSPPPRWVHFAHGLLLFLYQTFDAVDGKQARRTNSSSPLGELFDHGCDALGCALETMAYG 80 
42571453  90 STAMCGRDTFWFWVISAIPFYGATWEHYFTNTLILPVINGPTEGLALIFVSHFFTAIVGAEWWAQQLGQSIPLFSWVPFV 169
79313441  81 STAMCGRDTFWFWVISAVPFFGATWEHYFTNTLTLPVVNGPTEGLALIYCGHFFTAIVGAEWWAQPFGKSIPLFSWVPFL 160
42571453 170 NEIQTSRAVLYMMIAFAVIPTVAFNVTNVYKVVRSRNGSMVLALAMLYPFVVLLGGVLIWDYLSPINLIATYPHLVVLGT 249
79313441 161 NEMQMSRIILFSMIFFAVIPTLAINTSNVYKVVHSRNGSMLLALAMLYPLVTLIAGVLIWDYLSPIDLIRNYPHLVVLGT 240
42571453 250 GLAFGFLVGRMILAHLCDEPKGLKTNMCMSLLYLPFALANALTARLNAGVPLVDELWVLLGYCIFTVSLYLHFATSVIHE 329
79313441 241 GLAFGFLVGRMILAHLCDEPKGLKTNMCMSLLYLPFALANALTARLNDGVPLVDEFWVLLGYCIFTLSLYAHFATSVIHE 320
42571453 330 ITEALGIYCFRITRKEA 346
79313441 321 ITTALGIYCFRITRKEA 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap