Conserved Protein Domain Family
PLN03032

?
PLN03032: PLN03032 
serine decarboxylase; Provisional
Statistics
?
PSSM-Id: 166673
View PSSM: PLN03032
Aligned: 5 rows
Threshold Bit Score: 730.857
Threshold Setting Gi: 159462858
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159462858   1 TQEREAQIAEMIGSYMKKLAERTHHHMGYPYNLDFDYGLLEGLTKYSINNLGDPFIESNYGVHSREFEVGVLNWFARLWE 80 
168017461  18 TGEKDAYMASVLARYRKSLTEKSKYHLGYPYNLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWE 97 
219115978   1 --------SDILHAYDQLLQSKSSVHFGYPYNLMFDYTELAQFMKYSINNLGDPFVPSNYGVHSRQFEVAVIDFFAKLWK 72 
168003181   6 TGDRDAYMAGILARYRKTLVEKTKFHLGYPYNLDFDYGALSQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWE 85 
224006580   1 --------SDILASYDKLLKRKSSVHFGYPYNLMYNHEELYEFMKYSINNLGDPFITSNYGVHSRQFECSVIDFFAKLWK 72 
159462858  81 IDEEEYWGYITTCGTEGNLHGILVGRENFPDGVMYASSESHYSVFKAARMYRMEAEKVPTLESGEINYDDLKAALVKNAG 160
168017461  98 LEKDEYWGYITNCGTEGNLHGILVGREVLPDGILYASRDSHYSVFKAARMYRMEAVKVDTLLSGEIDCVDLERKLTEGKD 177
219115978  73 METDSYWGYVTTSGTEGNLHGILLAREKFPDGILYTSQETHYSVFKAARYYRMECQSIPTLPMGEIDYDCLSEAIARNRD 152
168003181  86 LEKEEYWGYITNCGTEGNLHGILVGREVLPDGILYASRDSHYSVFKAARMYRMEAVKVDTLLSGEIDCADFERKLTERKD 165
224006580  73 AEPDSYWGYVTTCGTEGNLHGILLARECHPDGILYSSRETHYSVFKAARYYRMDAKAIPTLPMGEIDYDALQSEIAKNRD 152
159462858 161 KPAILNVNIGTTVKGAVDDLDRVLEVLKEAGYTEDRFYIHCDGALFGMMMPFLSRdAPMVTFRKPIGSVSVSGHKFVGAP 240
168017461 178 KPAILNVNIGTTVKGAVDDLDLILKVLERVGYTEDRFYIHVDGALFGLMMPFVKK-APKVTFKKPIGSVSVSGHKFIGCP 256
219115978 153 KPVILNVNIGTTVKGAVDNLDRILRILQSLQIPREQFYIHCDGALFALMMPFVEF-APEVSFRKPIDSIAVSGHKMLGCP 231
168003181 166 KPAILNVNIGTTVKGAVDDLDLVLKTLEKVGYTEDRFYIHVDGALFGLMMPFVRR-APKVTFKKPIGSVSVSGHKFVGCP 244
224006580 153 RPVIINVNIGTTVKGAVDNLDRILRILKTLGIPRERFHIHCDGALFAMMMPFVDW-APEVSFQKPIDSIAVSGHKMLGCP 231
159462858 241 VPCGVIITRFKYVMALSSDVEYLNSRDATIMGSRNGHAPVYLWYTLTRKGYDGMRRDVEKCMRNAHVLQQMLESAGIRTM 320
168017461 257 MPCGVQFTRMKHINSLSRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKDVQRCLRNAHYLKERLREAKIGVM 336
219115978 232 MPCGVALSRKEHVKNLEQHIDYLNSVDTTIMGSRNGQAALYLWYSLRKKGIGGIKRDVMHCMETARYLKDALTAKGLTCR 311
168003181 245 MPCGVQITRMKHINVLSRNVEYLASRDATIMGSRNGHAPIFLWYTLNRKGYRGFQKEVQRCLRNAYYLKERLREANVGVL 324
224006580 232 MPCGIALTRKEHVKKVEQKIDYLNSVDTTIMGSRNGQAALYLWYSLRKKGIAGIKRDVVHCMETAQYLRDKITEAGLTCR 311
159462858 321 LNELSNTVVFERPKEEAFVRKWQLACEGEIAHVVVMPNITVEKLEEFVADYVQSR 375
168017461 337 LNELSSTVVFERPLDEAFILKWQLACQGKIAHAVVMPSVTVEKLDNFVEELIEVR 391
219115978 312 LNDLSSTVVLERPMDDDLVKRWQLACEEDIAHVVVMPNVTRYKIDLFVEELMQ-- 364
168003181 325 LNELSSTVVFERPLDEAFILKWQLACQGKIAHAVVMPSVTVEKLDDFVEELIEVR 379
224006580 312 LNDLSSTVVLERPMDDAFIKRWQLACEEDIAHVVVMPNVTRFKIDKFVEELVECK 366
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap