Conserved Protein Domain Family
PLN03019

?
PLN03019: PLN03019 
carbonic anhydrase
Statistics
?
PSSM-Id: 166660
View PSSM: PLN03019
Aligned: 4 rows
Threshold Bit Score: 579.024
Threshold Setting Gi: 145334412
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30685030    1 MVPFWTTVSRNGSSDSETTLQSASKATKQYKYPSLRPSHRLSLLFLFPFHLSANGACFRCTCFSHFKLELRRMGNESYED 80 
79327873    1 MVPFWTTVSRNGSSDSETTLQSASKATKQYKYPSLRPSHRLSLLFLFPFHLSANGACFRCTCFSHFKLELRRMGNESYED 80 
79327881    1 MVPFWTTVSRNGSSDSETTLQSASKATKQYKYPSLRPSHRLSLLFLFPFHLSANGACFRCTCFSHFKLELRRMGNESYED 80 
145334412   1 MVPFWTTVSRNGSSDSETTLQSASKATKQYKYPSLRPSHRLSLLFLFPFHLSANGACFRCTCFSHFKLELRRMGNESYED 80 
30685030   81 AIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERIKEGFVTFKKEKYETNPALYGELAKGQSPKYMVF 160
79327873   81 AIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERIKEGFVTFKKEKYETNPALYGELAKGQSPKYMVF 160
79327881   81 AIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERIKEGFVTFKKEKYETNPALYGELAKGQSPKYMVF 160
145334412  81 AIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERIKEGFVTFKKEKYETNPALYGELAKGQSPKYMVF 160
30685030  161 ACSDSRVCPSHVLDFHPGDAFVVRNIANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNN 240
79327873  161 ACSDSRVCPSHVLDFHPGDAFVVRNIANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNN 240
79327881  161 ACSDSRVCPSHVLDFHPGDAFVVRNIANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNN 240
145334412 161 ACSDSRVCPSHVLDFHPGDAFVVRNIANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNN 240
30685030  241 STDFIEDWVKICLPAKSKVLAESESSAFEDQCGRCEReAVNVSLANLLTYPFVREGVVKGTLALKGGYYDFV-------- 312
79327873  241 STDFIEDWVKICLPAKSKVLAESESSAFEDQCGRCER-VLNVSLANLLTYPFVREGVVKGTLALKGGYYDFV-------- 311
79327881  241 STDFIEDWVKICLPAKSKVLAESESSAFEDQCGRCER-AVNVSLANLLTYPFVREGVVKGTLALKGGYYDFV-------- 311
145334412 241 STDFIEDWVKICLPAKSKVLAESESSAFEDQCGRCER--------------------VRGSECVTSKPIDISicerrsce 300
30685030  313 -NGSFELWELQFGISPVHSI 331
79327873  312 -NGSFELWELQFGISPVHSI 330
79327881  312 -NGSFELWELQFGISPVHSI 330
145334412 301 rNTCFEGRLL---------- 310
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap