Conserved Protein Domain Family
PLN03009

?
PLN03009: PLN03009 
cellulase
Statistics
?
PSSM-Id: 166650
View PSSM: PLN03009
Aligned: 4 rows
Threshold Bit Score: 989.483
Threshold Setting Gi: 297801988
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18420359    2 KLHLHPLSLVFFFFFFFFRPTMSSNQHDYSDALSKSILFFEGQRSGYLPNDQRMTWRRNSGLSDGWTHNIDLTGGYYDAG 81 
225427760   1 MPIPRTVFLISLLLLILRLPRFESANHDYSDALSKCILFFEGQRSGFLPNGQRISWRANSGLSDGWQRSVDLTGGYYDAG 80 
224077913   1 ---------------------MEDNYHEYQDALSKSILFFEGQRSGYLPQDQRVTWRANSGLSDGWTYNTDLTGGYYDAG 59 
297801988   2 KLHLYPLSLVFSFFLLLLRPTMSSNQHDYSDALSKSILFFEGQRSGYLPNDQRMTWRRNSGLSDGWTHNTDLTGGYYDAG 81 
18420359   82 DNVKFNFPMAFTTTMLAWSVIEFGEFMPSSELRNSLVALRWSSNYLLKSVSQlPNRIFVQVGDPIADHNCWERPEDMDTP 161
225427760  81 DNIKFGFPMAFTTTMLAWSVIEFGDSMPAGELRNTMVAIRWATDYLLKTVSQ-PGRIFVQVGDPIIDHNCWERPEDMDTA 159
224077913  60 DNVKFGFPMAFTTTMLAWSVNEFGDLMPPNELRNSLVAIRWATDYLLKTVSQ-PNRIFVQVGDPNGDHICWERPEDMDTP 138
297801988  82 DNVKFNFPMAFTTTMLAWSVIEFGELMPSSELRNSLVALRWSSNYLLKSVSQlPNRIFVQVGDPIADHNCWERPEDMDTP 161
18420359  162 RTAYAVNAPNPASEVAGETTAALSAASIAFRSSDPGYSQTLLQNAVKTFQFADMYRGAYSSNDDIKNDVCPFYCDFNGFQ 241
225427760 160 RTVYAVEAPNPASDVAGETAAAFAASSMAFRSSDPGYSETLLRNAISVFQYADNYRGAYSDNADIRDGVCPFYCDFDGYQ 239
224077913 139 RVVYAVDAPNPASDVAGETAAALAASSMAFRSSDPGYAETLLRNAINAFQFADSYRGAYSDNSNIKDGACPFYCDFDGYQ 218
297801988 162 RTAYVVNAPNPASEVAGETTAALSAASIAFRSSDAGYSQTLLQNAVKTFHFADMYRGAYSSNDDIKNDVCPFYCDFNGFQ 241
18420359  242 DELLWGAAWLRKATGDESYLNYIESNREPFGANDNVDEFGWDNKVGGLNVLVSKEVIEGNMYNLEAYKASAESFMCSLVP 321
225427760 240 DELLWGAAWLRRASQDDSYLNYIENNGKTLGAEDNINEFGWDNKHAGLNVLVSKEFLEGSMYSLQSYKASADSFMCTLIP 319
224077913 219 DELLWGAAWLRRASYDDTYLSFLQNNGETLGADENINEFGWDNKHAGLNVLVSKEVLEGNMNSLQSYKESADSFMCTLIP 298
297801988 242 DELLWGAAWLRKATGDESYLNYIESNREPFGANDNVDEFGWDNKVGGLNVLVSKEVIEGNMYNLEAYKASAESFMCSLVP 321
18420359  322 ESSGPHVEYTSAGLLYKPGGSQLQHATTISFLLLVYAQYLSRSSLSLNCGTLTVPPDYLRRLAKKQVDYILGNNPMGLSY 401
225427760 320 ESSSSHIEYSPGGLIYKPGGSNLQHATSIAFLLLSYANYLARSGQSVNCGNISIGPSSLRQQAKRQIDYILGDNPMGMSY 399
224077913 299 ESSSSHVEYTPGGLIYKPGGSNLQHATTISFLLLAYANYLERTSQSVNCGNVNVGPYSLRQQAKRQVDYILGDNPLGLSY 378
297801988 322 QSSGPHVEYTPAGLLYKPGGSQLQHATTISFLLLVYAQYLSRSSLSLNCGTLTIPPDHLRRLAKKQVNYILGDNPMGLSY 401
18420359  402 MVGYGERYPKRIHHRGSSLPSIVDHPEAIRCKDGSVYFNSTEPNPNVLIGAVVGGPGEDDMYDDDRSDFRKSEPTTYINA 481
225427760 400 MVGYSNYFPQRIHHRGSSLPSIKDHPEFIACKEGSAYFNSSNPNPNILVGAVVGGPGDDDSYEDDRDDFRKSEPTTYINA 479
224077913 379 MVGYSDHYPQRIHHRGSSLPSVKDHPDLIACKEGSIYCNSSNPNPNVHVGAIVGGPSEDDSYEDSRDDFRKSEPTTYINA 458
297801988 402 MVGYGERYPKRIHHRGSSLPSIKDHPEAIRCKDGSVYFNSTEPNPNVLIGAVVGGPGEDDKYDDDRSDFRKSEPTTYINA 481
18420359  482 PFVGVLAYFAANPGSS 497
225427760 480 PLVGALAYFVANPNPS 495
224077913 459 PFVGVLAYFAANPSFS 474
297801988 482 PFVGVLAYFAANPGSS 497
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap