Conserved Protein Domain Family
PLN03001

?
PLN03001: PLN03001 
oxidoreductase, 2OG-Fe(II) oxygenase family protein
Statistics
?
PSSM-Id: 166642
View PSSM: PLN03001
Aligned: 2 rows
Threshold Bit Score: 569.299
Threshold Setting Gi: 240255924
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225464718   1 MRSVGLSFFKDSPMSHKLSYACPPGSAASEGYGSRMLVSTSNDTVLDWRDFFDHHTLPLSRRNPSRWPDFPPNYREVVVE 80 
240255924   1 MRSLGLSFFQDSPMEEKLRYACDSTSAASEGYGSRMLLGAKDDVVLDWRDYFDHHTFPPSRRNPSHWPIHPSDYRQVVGE 80 
225464718  81 YSDCMKALAQKLLAFMSESLGLPSSCIEDAVGDFYQNITVSYYPPCPQPELTLGLQSHSDMGAITLLIQDDVGGLQVLKD 160
240255924  81 YGDEMKKLAQMLLGLISESLGLPCSSIEEAVGEIYQNITVTYYPPCPQPELTLGLQSHSDFGAITLLIQDDVEGLQLYKD 160
225464718 161 GEWVMVQPLSDAIVVILADQTEIITNGNYRSAQHRAIANANKARLSVATFHDPAKTMKISPASALVtesfPPRYCQIVYG 240
240255924 161 AQWLTVPPISDAILILIADQTEIITNGRYKSAQHRAVTNANRARLSVATFHDPSKTARIAPVSQLS----PPSYKEVVYG 236
225464718 241 EYVSSWYTKGPEGKRNIDALML 262
240255924 237 QYVSSWYSKGPEGKRNLDALLY 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap